Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTC2V1K6)

• DOT Name: Heat shock 70 kDa protein 1-like (HSPA1L)
• Synonyms: Heat shock 70 kDa protein 1L; Heat shock 70 kDa protein 1-Hom; HSP70-Hom
• Gene Name: HSPA1L
• Related Disease:
  Spondyloarthropathy
  Tuberculosis
  Acute graft versus host disease
  Adult lymphoma
  Advanced cancer
  Ankylosing spondylitis
  Atrial fibrillation
  Autoimmune disease
  Bipolar disorder
  Breast carcinoma
  Cataract
  Childhood acute lymphoblastic leukemia
  Chronic hepatitis B virus infection
  Colorectal carcinoma
  Graft-versus-host disease
  Hepatocellular carcinoma
  Inflammatory bowel disease
  Liver failure
  Lung cancer
  Lung carcinoma
  Lymphoma
  Lymphoma, non-Hodgkin, familial
  Major depressive disorder
  Multiple sclerosis
  Myocardial infarction
  Non-hodgkin lymphoma
  Pediatric lymphoma
  Systemic lupus erythematosus
  Systemic sclerosis
  Type-1 diabetes
  Uveitis
  Chronic graft versus host disease
  High blood pressure
  Stroke
  Parkinson disease
  Prostate cancer
  Prostate carcinoma
  Rheumatoid arthritis
  Sarcoidosis
  Ulcerative colitis
• UniProt ID: HS71L_HUMAN
• PDB ID: 3GDQ
• Pfam ID: PF00012
• Sequence:
  MATAKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
  VAMNPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEE
  ISSMVLTKLKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
  AAIAYGLDKGGQGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLV
  SHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSIT
  RARFEELCADLFRGTLEPVEKALRDAKMDKAKIHDIVLVGGSTRIPKVQRLLQDYFNGRD
  LNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTALIKRNS
  TIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPQIEVTF
  DIDANGILNVTATDKSTGKVNKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAA
  KNALESYAFNMKSVVSDEGLKGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKE
  LEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD
• Function: Molecular chaperone implicated in a wide variety of cellular processes, including protection of the proteome from stress, folding and transport of newly synthesized polypeptides, activation of proteolysis of misfolded proteins and the formation and dissociation of protein complexes. Plays a pivotal role in the protein quality control system, ensuring the correct folding of proteins, the re-folding of misfolded proteins and controlling the targeting of proteins for subsequent degradation. This is achieved through cycles of ATP binding, ATP hydrolysis and ADP release, mediated by co-chaperones. The affinity for polypeptides is regulated by its nucleotide bound state. In the ATP-bound form, it has a low affinity for substrate proteins. However, upon hydrolysis of the ATP to ADP, it undergoes a conformational change that increases its affinity for substrate proteins. It goes through repeated cycles of ATP hydrolysis and nucleotide exchange, which permits cycles of substrate binding and release. Positive regulator of PRKN translocation to damaged mitochondria.
• Tissue Specificity: Expressed in spermatids.
• KEGG Pathway:
  Spliceosome (hsa03040)
  MAPK sig.ling pathway (hsa04010)
  Protein processing in endoplasmic reticulum (hsa04141)
  Endocytosis (hsa04144)
  Longevity regulating pathway - multiple species (hsa04213)
  Antigen processing and presentation (hsa04612)
  Estrogen sig.ling pathway (hsa04915)
  Prion disease (hsa05020)
  Legionellosis (hsa05134)
  Toxoplasmosis (hsa05145)
  Measles (hsa05162)
  Lipid and atherosclerosis (hsa05417)
• Reactome Pathway:
  HSP90 chaperone cycle for steroid hormone receptors (SHR) in the presence of ligand (R-HSA-3371497)
  Attenuation phase (R-HSA-3371568)
  HSF1-dependent transactivation (R-HSA-3371571)
  PKR-mediated signaling (R-HSA-9833482)
  Regulation of HSF1-mediated heat shock response (R-HSA-3371453)

Molecular Interaction Atlas (MIA) of This DOT

40 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Spondyloarthropathy	DISBPYCZ	Definitive	Genetic Variation	[1]
Tuberculosis	DIS2YIMD	Definitive	Genetic Variation	[2]
Acute graft versus host disease	DIS8KLVM	Strong	Altered Expression	[3]
Adult lymphoma	DISK8IZR	Strong	Biomarker	[4]
Advanced cancer	DISAT1Z9	Strong	Genetic Variation	[5]
Ankylosing spondylitis	DISRC6IR	Strong	Genetic Variation	[1]
Atrial fibrillation	DIS15W6U	Strong	Genetic Variation	[6]
Autoimmune disease	DISORMTM	Strong	Genetic Variation	[7]
Bipolar disorder	DISAM7J2	Strong	Biomarker	[8]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[4]
Cataract	DISUD7SL	Strong	Genetic Variation	[9]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Strong	Genetic Variation	[10]
Chronic hepatitis B virus infection	DISHL4NT	Strong	Genetic Variation	[11]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[12]
Graft-versus-host disease	DIS0QADF	Strong	Altered Expression	[3]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[11]
Inflammatory bowel disease	DISGN23E	Strong	Genetic Variation	[13]
Liver failure	DISLGEL6	Strong	Genetic Variation	[14]
Lung cancer	DISCM4YA	Strong	Genetic Variation	[15]
Lung carcinoma	DISTR26C	Strong	Genetic Variation	[15]
Lymphoma	DISN6V4S	Strong	Biomarker	[4]
Lymphoma, non-Hodgkin, familial	DISCXYIZ	Strong	Genetic Variation	[4]
Major depressive disorder	DIS4CL3X	Strong	Biomarker	[16]
Multiple sclerosis	DISB2WZI	Strong	Genetic Variation	[17]
Myocardial infarction	DIS655KI	Strong	Biomarker	[6]
Non-hodgkin lymphoma	DISS2Y8A	Strong	Genetic Variation	[4]
Pediatric lymphoma	DIS51BK2	Strong	Biomarker	[4]
Systemic lupus erythematosus	DISI1SZ7	Strong	Genetic Variation	[18]
Systemic sclerosis	DISF44L6	Strong	Genetic Variation	[19]
Type-1 diabetes	DIS7HLUB	Strong	Genetic Variation	[20]
Uveitis	DISV0RYS	Strong	Genetic Variation	[21]
Chronic graft versus host disease	DIS1MM9J	moderate	Biomarker	[3]
High blood pressure	DISY2OHH	moderate	Genetic Variation	[22]
Stroke	DISX6UHX	moderate	Genetic Variation	[23]
Parkinson disease	DISQVHKL	Limited	Genetic Variation	[24]
Prostate cancer	DISF190Y	Limited	Genetic Variation	[25]
Prostate carcinoma	DISMJPLE	Limited	Genetic Variation	[25]
Rheumatoid arthritis	DISTSB4J	Limited	Genetic Variation	[26]
Sarcoidosis	DISE5B8Z	Limited	Genetic Variation	[21]
Ulcerative colitis	DIS8K27O	Limited	Genetic Variation	[27]

This DOT Affected the Drug Response of 3 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Carbamazepine	DMZOLBI	Approved	Heat shock 70 kDa protein 1-like (HSPA1L) affects the response to substance of Carbamazepine.	[53]
Sulforaphane	DMQY3L0	Investigative	Heat shock 70 kDa protein 1-like (HSPA1L) affects the binding of Sulforaphane.	[54]
Paraquat	DMR8O3X	Investigative	Heat shock 70 kDa protein 1-like (HSPA1L) decreases the response to substance of Paraquat.	[55]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Heat shock 70 kDa protein 1-like (HSPA1L).	[28]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Heat shock 70 kDa protein 1-like (HSPA1L).	[43]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Heat shock 70 kDa protein 1-like (HSPA1L).	[47]

21 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Heat shock 70 kDa protein 1-like (HSPA1L).	[29]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Heat shock 70 kDa protein 1-like (HSPA1L).	[30]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Heat shock 70 kDa protein 1-like (HSPA1L).	[31]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Heat shock 70 kDa protein 1-like (HSPA1L).	[32]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of Heat shock 70 kDa protein 1-like (HSPA1L).	[33]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Heat shock 70 kDa protein 1-like (HSPA1L).	[34]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Heat shock 70 kDa protein 1-like (HSPA1L).	[35]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Heat shock 70 kDa protein 1-like (HSPA1L).	[36]
Gemcitabine	DMSE3I7	Approved	Gemcitabine decreases the expression of Heat shock 70 kDa protein 1-like (HSPA1L).	[37]
Isoproterenol	DMK7MEY	Approved	Isoproterenol decreases the expression of Heat shock 70 kDa protein 1-like (HSPA1L).	[38]
Penicillamine	DM40EF6	Approved	Penicillamine increases the expression of Heat shock 70 kDa protein 1-like (HSPA1L).	[39]
Teriflunomide	DMQ2FKJ	Approved	Teriflunomide decreases the expression of Heat shock 70 kDa protein 1-like (HSPA1L).	[40]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Heat shock 70 kDa protein 1-like (HSPA1L).	[41]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of Heat shock 70 kDa protein 1-like (HSPA1L).	[42]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Heat shock 70 kDa protein 1-like (HSPA1L).	[44]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Heat shock 70 kDa protein 1-like (HSPA1L).	[45]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Heat shock 70 kDa protein 1-like (HSPA1L).	[46]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Heat shock 70 kDa protein 1-like (HSPA1L).	[48]
QUERCITRIN	DM1DH96	Investigative	QUERCITRIN affects the expression of Heat shock 70 kDa protein 1-like (HSPA1L).	[50]
crotylaldehyde	DMTWRQI	Investigative	crotylaldehyde increases the expression of Heat shock 70 kDa protein 1-like (HSPA1L).	[51]
L-Serine	DM6WPIS	Investigative	L-Serine increases the expression of Heat shock 70 kDa protein 1-like (HSPA1L).	[52]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal affects the binding of Heat shock 70 kDa protein 1-like (HSPA1L).	[49]

References

• [1] Heat shock protein 70 gene polymorphisms in Mexican patients with spondyloarthropathies.Ann Rheum Dis. 2002 Jan;61(1):48-51. doi: 10.1136/ard.61.1.48.
• [2] Analysis of IL-6, STAT3 and HSPA1L gene polymorphisms in anti-tuberculosis drug-induced hepatitis in a nested case-control study.PLoS One. 2015 Mar 19;10(3):e0118862. doi: 10.1371/journal.pone.0118862. eCollection 2015.
• [3] Elevated level of HSPA1L mRNA correlates with graft-versus-host disease.Transpl Immunol. 2015 Jun;32(3):188-94. doi: 10.1016/j.trim.2015.02.002. Epub 2015 Feb 11.
• [4] Polymorphism in the tumor necrosis factor-alpha promotor region and in the heat shock protein 70 genes associated with malignant tumors.Cancer. 1997 Oct 15;80(8):1489-96. doi: 10.1002/(sici)1097-0142(19971015)80:8<1489::aid-cncr17>3.0.co;2-1.
• [5] Association of HSP70-hom genetic variant with prostate cancer risk.Mol Biol Rep. 2008 Sep;35(3):459-64. doi: 10.1007/s11033-007-9107-1. Epub 2007 Jun 20.
• [6] Association of Met439Thr substitution in heat shock protein 70 gene with postoperative atrial fibrillation and serum HSP70 protein levels.Cardiology. 2008;110(1):45-52. doi: 10.1159/000109406. Epub 2007 Oct 10.
• [7] HSP70-Hom NcoI polymorphism and HLA-associations in the Finnish population and in patients with ankylosing spondylitis or reactive arthritis.Eur J Immunogenet. 1994 Apr;21(2):81-90. doi: 10.1111/j.1744-313x.1994.tb00179.x.
• [8] Integrated transcriptome and methylome analysis in youth at high risk for bipolar disorder: a preliminary analysis.Transl Psychiatry. 2017 Mar 14;7(3):e1059. doi: 10.1038/tp.2017.32.
• [9] Genetic polymorphisms of HSP70 in age-related cataract.Cell Stress Chaperones. 2013 Nov;18(6):703-9. doi: 10.1007/s12192-013-0420-4. Epub 2013 May 11.
• [10] HLA complex-linked heat shock protein genes and childhood acute lymphoblastic leukemia susceptibility.Cell Stress Chaperones. 2010 Sep;15(5):475-85. doi: 10.1007/s12192-009-0161-6. Epub 2009 Dec 9.
• [11] Genetic variants of heat shock protein A1L2437 and A1B1267 as possible risk factors for hepatocellular carcinoma in India.J Viral Hepat. 2013 Apr;20(4):e141-7. doi: 10.1111/jvh.12021. Epub 2012 Nov 20.
• [12] Role of HSPA1L as a cellular prion protein stabilizer in tumor progression via HIF-1/GP78 axis.Oncogene. 2017 Nov 23;36(47):6555-6567. doi: 10.1038/onc.2017.263. Epub 2017 Jul 31.
• [13] De novo and rare mutations in the HSPA1L heat shock gene associated with inflammatory bowel disease.Genome Med. 2017 Jan 26;9(1):8. doi: 10.1186/s13073-016-0394-9.
• [14] Heat shock protein 70 genotypes HSPA1B and HSPA1L influence cytokine concentrations and interfere with outcome after major injury.Crit Care Med. 2003 Jan;31(1):73-9. doi: 10.1097/00003246-200301000-00011.
• [15] The relationship between three heat shock protein 70 gene polymorphisms and susceptibility to lung cancer.Clin Chem Lab Med. 2010 Nov;48(11):1657-63. doi: 10.1515/CCLM.2010.304. Epub 2010 Aug 13.
• [16] Heat-shock protein-70 genes and response to antidepressants in major depression.Prog Neuropsychopharmacol Biol Psychiatry. 2007 Jun 30;31(5):1006-11. doi: 10.1016/j.pnpbp.2007.02.011. Epub 2007 Feb 27.
• [17] Heat shock protein 70-hom gene polymorphism and protein expression in multiple sclerosis.J Neuroimmunol. 2016 Sep 15;298:189-93. doi: 10.1016/j.jneuroim.2016.07.011. Epub 2016 Jul 15.
• [18] Polymorphisms in the Hsp70 gene locus are genetically associated with systemic lupus erythematosus.Ann Rheum Dis. 2010 Nov;69(11):1983-9. doi: 10.1136/ard.2009.122630. Epub 2010 May 24.
• [19] Genome-wide association study of systemic sclerosis identifies CD247 as a new susceptibility locus.Nat Genet. 2010 May;42(5):426-9. doi: 10.1038/ng.565. Epub 2010 Apr 11.
• [20] A genome-wide association study identifies KIAA0350 as a type 1 diabetes gene.Nature. 2007 Aug 2;448(7153):591-4. doi: 10.1038/nature06010. Epub 2007 Jul 15.
• [21] Association between heat shock protein 70/Hom genetic polymorphisms and uveitis in patients with sarcoidosis.Invest Ophthalmol Vis Sci. 2007 Jul;48(7):3019-25. doi: 10.1167/iovs.06-1485.
• [22] Interaction of heat shock protein 70 (HSP70) polymorphisms and occupational hazards increases the risk of hypertension in coke oven workers.Occup Environ Med. 2018 Nov;75(11):807-813. doi: 10.1136/oemed-2018-105160. Epub 2018 Sep 14.
• [23] A prospective evaluation of the heat shock protein 70 gene polymorphisms and the risk of stroke.Thromb Haemost. 2002 Apr;87(4):622-5.
• [24] Analysis of heat-shock protein 70 gene polymorphisms and the risk of Parkinson's disease.Hum Genet. 2004 Feb;114(3):236-41. doi: 10.1007/s00439-003-1050-1. Epub 2003 Nov 6.
• [25] Synergistic effect and VEGF/HSP70-hom haplotype analysis: relationship to prostate cancer risk and clinical outcome.Hum Immunol. 2010 Apr;71(4):377-82. doi: 10.1016/j.humimm.2010.01.017. Epub 2010 Feb 4.
• [26] A genome-wide association study suggests contrasting associations in ACPA-positive versus ACPA-negative rheumatoid arthritis.Ann Rheum Dis. 2011 Feb;70(2):259-65. doi: 10.1136/ard.2009.126821. Epub 2010 Dec 14.
• [27] Genome-wide association scan in north Indians reveals three novel HLA-independent risk loci for ulcerative colitis.Gut. 2015 Apr;64(4):571-9. doi: 10.1136/gutjnl-2013-306625. Epub 2014 May 16.
• [28] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [29] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [30] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [31] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [32] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [33] Nucleophosmin in the pathogenesis of arsenic-related bladder carcinogenesis revealed by quantitative proteomics. Toxicol Appl Pharmacol. 2010 Jan 15;242(2):126-35. doi: 10.1016/j.taap.2009.09.016. Epub 2009 Oct 7.
• [34] Gene expression profile induced by arsenic trioxide in chronic lymphocytic leukemia cells reveals a central role for heme oxygenase-1 in apoptosis and regulation of matrix metalloproteinase-9. Oncotarget. 2016 Dec 13;7(50):83359-83377.
• [35] Gene expression changes in human small airway epithelial cells exposed to Delta9-tetrahydrocannabinol. Toxicol Lett. 2005 Aug 14;158(2):95-107.
• [36] Increased sensitivity for troglitazone-induced cytotoxicity using a human in vitro co-culture model. Toxicol In Vitro. 2009 Oct;23(7):1387-95.
• [37] Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
• [38] Isoproterenol effects evaluated in heart slices of human and rat in comparison to rat heart in vivo. Toxicol Appl Pharmacol. 2014 Jan 15;274(2):302-12.
• [39] D-Penicillamine targets metastatic melanoma cells with induction of the unfolded protein response (UPR) and Noxa (PMAIP1)-dependent mitochondrial apoptosis. Apoptosis. 2012 Oct;17(10):1079-94.
• [40] Mitochondrial dysfunction induced by leflunomide and its active metabolite. Toxicology. 2018 Mar 1;396-397:33-45.
• [41] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [42] Impact of epigallocatechin gallate on gene expression profiles of human hepatocellular carcinoma cell lines BEL7404/ADM and BEL7402/5-FU. Ai Zheng. 2008 Oct;27(10):1056-64.
• [43] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [44] Loss of TRIM33 causes resistance to BET bromodomain inhibitors through MYC- and TGF-beta-dependent mechanisms. Proc Natl Acad Sci U S A. 2016 Aug 2;113(31):E4558-66.
• [45] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [46] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [47] Genome-wide alteration in DNA hydroxymethylation in the sperm from bisphenol A-exposed men. PLoS One. 2017 Jun 5;12(6):e0178535. doi: 10.1371/journal.pone.0178535. eCollection 2017.
• [48] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [49] Identification of protein targets of 4-hydroxynonenal using click chemistry for ex vivo biotinylation of azido and alkynyl derivatives. Chem Res Toxicol. 2008 Feb;21(2):432-44. doi: 10.1021/tx700347w. Epub 2008 Jan 31.
• [50] Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.
• [51] Gene expression profile and cytotoxicity of human bronchial epithelial cells exposed to crotonaldehyde. Toxicol Lett. 2010 Aug 16;197(2):113-22.
• [52] Mechanisms of L-Serine Neuroprotection in vitro Include ER Proteostasis Regulation. Neurotox Res. 2018 Jan;33(1):123-132. doi: 10.1007/s12640-017-9829-3. Epub 2017 Nov 2.
• [53] Serious carbamazepine-induced hypersensitivity reactions associated with the HSP70 gene cluster. Pharmacogenet Genomics. 2006 Apr;16(4):287-96. doi: 10.1097/01.fpc.0000189800.88596.7a.
• [54] Identification of potential protein targets of isothiocyanates by proteomics. Chem Res Toxicol. 2011 Oct 17;24(10):1735-43. doi: 10.1021/tx2002806. Epub 2011 Aug 26.
• [55] Heat shock protein-70 (Hsp-70) suppresses paraquat-induced neurodegeneration by inhibiting JNK and caspase-3 activation in Drosophila model of Parkinson's disease. PLoS One. 2014 Jun 2;9(6):e98886. doi: 10.1371/journal.pone.0098886. eCollection 2014.