Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTC59BCO)

• DOT Name: Histone-lysine N-methyltransferase 2C (KMT2C)
• Synonyms: Lysine N-methyltransferase 2C; EC 2.1.1.364; Homologous to ALR protein; Myeloid/lymphoid or mixed-lineage leukemia protein 3
• Gene Name: KMT2C
• Related Disease:
  Estrogen-receptor positive breast cancer
  Neurodevelopmental disorder
  Syndromic intellectual disability
  Acute lymphocytic leukaemia
  Acute myelogenous leukaemia
  Adenocarcinoma
  Advanced cancer
  Autism spectrum disorder
  Bone osteosarcoma
  Breast neoplasm
  Colorectal carcinoma
  Dilated cardiomyopathy 1A
  Endometrial cancer
  Endometrial carcinoma
  Esophageal squamous cell carcinoma
  Gastric cancer
  Gastric neoplasm
  Glioma
  Head and neck carcinoma
  Hepatocellular carcinoma
  Hereditary diffuse gastric adenocarcinoma
  Intellectual disability, autosomal dominant 40
  Kleefstra syndrome 2
  leukaemia
  Medulloblastoma
  Myelodysplastic syndrome
  Neoplasm
  Osteosarcoma
  Pancreatic tumour
  Prostate cancer
  Prostate neoplasm
  Schizophrenia
  Sezary syndrome
  Stomach cancer
  Intellectual disability
  Nasopharyngeal carcinoma
  Cholangiocarcinoma
  Intrahepatic cholangiocarcinoma
  Leukemia
  Lung cancer
  Lung carcinoma
  Transitional cell carcinoma
  Urinary bladder cancer
  Urinary bladder neoplasm
• UniProt ID: KMT2C_HUMAN
• PDB ID: 2YSM; 2YUK; 3UVL; 4ERY; 5F59; 5F6K; 6KIW; 6MLC; 7W6L
• EC Number: 2.1.1.364
• Pfam ID: PF05965 ; PF05964 ; PF00628 ; PF00856 ; PF13771 ; PF13832
• Sequence:
  MSSEEDKSVEQPQPPPPPPEEPGAPAPSPAAADKRPRGRPRKDGASPFQRARKKPRSRGK
  TAVEDEDSMDGLETTETETIVETEIKEQSAEEDAEAEVDNSKQLIPTLQRSVSEESANSL
  VSVGVEAKISEQLCAFCYCGEKSSLGQGDLKQFRITPGFILPWRNQPSNKKDIDDNSNGT
  YEKMQNSAPRKQRGQRKERSPQQNIVSCVSVSTQTASDDQAGKLWDELSLVGLPDAIDIQ
  ALFDSTGTCWAHHRCVEWSLGVCQMEEPLLVNVDKAVVSGSTERCAFCKHLGATIKCCEE
  KCTQMYHYPCAAGAGTFQDFSHIFLLCPEHIDQAPERSKEDANCAVCDSPGDLLDQFFCT
  TCGQHYHGMCLDIAVTPLKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQP
  VMKSVPTNGWKCKNCRICIECGTRSSSQWHHNCLICDNCYQQQDNLCPFCGKCYHPELQK
  DMLHCNMCKRWVHLECDKPTDHELDTQLKEEYICMYCKHLGAEMDRLQPGEEVEIAELTT
  DYNNEMEVEGPEDQMVFSEQAANKDVNGQESTPGIVPDAVQVHTEEQQKSHPSESLDTDS
  LLIAVSSQHTVNTELEKQISNEVDSEDLKMSSEVKHICGEDQIEDKMEVTENIEVVTHQI
  TVQQEQLQLLEEPETVVSREESRPPKLVMESVTLPLETLVSPHEESISLCPEEQLVIERL
  QGEKEQKENSELSTGLMDSEMTPTIEGCVKDVSYQGGKSIKLSSETESSFSSSADISKAD
  VSSSPTPSSDLPSHDMLHNYPSALSSSAGNIMPTTYISVTPKIGMGKPAITKRKFSPGRP
  RSKQGAWSTHNTVSPPSWSPDISEGREIFKPRQLPGSAIWSIKVGRGSGFPGKRRPRGAG
  LSGRGGRGRSKLKSGIGAVVLPGVSTADISSNKDDEENSMHNTVVLFSSSDKFTLNQDMC
  VVCGSFGQGAEGRLLACSQCGQCYHPYCVSIKITKVVLSKGWRCLECTVCEACGKATDPG
  RLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCVWCRHCGATSAGLRCEWQNNYTQCAP
  CASLSSCPVCYRNYREEDLILQCRQCDRWMHAVCQNLNTEEEVENVADIGFDCSMCRPYM
  PASNVPSSDCCESSLVAQIVTKVKELDPPKTYTQDGVCLTESGMTQLQSLTVTVPRRKRS
  KPKLKLKIINQNSVAVLQTPPDIQSEHSRDGEMDDSREGELMDCDGKSESSPEREAVDDE
  TKGVEGTDGVKKRKRKPYRPGIGGFMVRQRSRTGQGKTKRSVIRKDSSGSISEQLPCRDD
  GWSEQLPDTLVDESVSVTESTEKIKKRYRKRKNKLEETFPAYLQEAFFGKDLLDTSRQSK
  ISLDNLSEDGAQLLYKTNMNTGFLDPSLDPLLSSSSAPTKSGTHGPADDPLADISEVLNT
  DDDILGIISDDLAKSVDHSDIGPVTDDPSSLPQPNVNQSSRPLSEEQLDGILSPELDKMV
  TDGAILGKLYKIPELGGKDVEDLFTAVLSPANTQPTPLPQPPPPTQLLPIHNQDAFSRMP
  LMNGLIGSSPHLPHNSLPPGSGLGTFSAIAQSSYPDARDKNSAFNPMASDPNNSWTSSAP
  TVEGENDTMSNAQRSTLKWEKEEALGEMATVAPVLYTNINFPNLKEEFPDWTTRVKQIAK
  LWRKASSQERAPYVQKARDNRAALRINKVQMSNDSMKRQQQQDSIDPSSRIDSELFKDPL
  KQRESEHEQEWKFRQQMRQKSKQQAKIEATQKLEQVKNEQQQQQQQQFGSQHLLVQSGSD
  TPSSGIQSPLTPQPGNGNMSPAQSFHKELFTKQPPSTPTSTSSDDVFVKPQAPPPPPAPS
  RIPIQDSLSQAQTSQPPSPQVFSPGSSNSRPPSPMDPYAKMVGTPRPPPVGHSFSRRNSA
  APVENCTPLSSVSRPLQMNETTANRPSPVRDLCSSSTTNNDPYAKPPDTPRPVMTDQFPK
  SLGLSRSPVVSEQTAKGPIAAGTSDHFTKPSPRADVFQRQRIPDSYARPLLTPAPLDSGP
  GPFKTPMQPPPSSQDPYGSVSQASRRLSVDPYERPALTPRPIDNFSHNQSNDPYSQPPLT
  PHPAVNESFAHPSRAFSQPGTISRPTSQDPYSQPPGTPRPVVDSYSQSSGTARSNTDPYS
  QPPGTPRPTTVDPYSQQPQTPRPSTQTDLFVTPVTNQRHSDPYAHPPGTPRPGISVPYSQ
  PPATPRPRISEGFTRSSMTRPVLMPNQDPFLQAAQNRGPALPGPLVRPPDTCSQTPRPPG
  PGLSDTFSRVSPSAARDPYDQSPMTPRSQSDSFGTSQTAHDVADQPRPGSEGSFCASSNS
  PMHSQGQQFSGVSQLPGPVPTSGVTDTQNTVNMAQADTEKLRQRQKLREIILQQQQQKKI
  AGRQEKGSQDSPAVPHPGPLQHWQPENVNQAFTRPPPPYPGNIRSPVAPPLGPRYAVFPK
  DQRGPYPPDVASMGMRPHGFRFGFPGGSHGTMPSQERFLVPPQQIQGSGVSPQLRRSVSV
  DMPRPLNNSQMNNPVGLPQHFSPQSLPVQQHNILGQAYIELRHRAPDGRQRLPFSAPPGS
  VVEASSNLRHGNFIPRPDFPGPRHTDPMRRPPQGLPNQLPVHPDLEQVPPSQQEQGHSVH
  SSSMVMRTLNHPLGGEFSEAPLSTSVPSETTSDNLQITTQPSDGLEEKLDSDDPSVKELD
  VKDLEGVEVKDLDDEDLENLNLDTEDGKVVELDTLDNLETNDPNLDDLLRSGEFDIIAYT
  DPELDMGDKKSMFNEELDLPIDDKLDNQCVSVEPKKKEQENKTLVLSDKHSPQKKSTVTN
  EVKTEVLSPNSKVESKCETEKNDENKDNVDTPCSQASAHSDLNDGEKTSLHPCDPDLFEK
  RTNRETAGPSANVIQASTQLPAQDVINSCGITGSTPVLSSLLANEKSDNSDIRPSGSPPP
  PTLPASPSNHVSSLPPFIAPPGRVLDNAMNSNVTVVSRVNHVFSQGVQVNPGLIPGQSTV
  NHSLGTGKPATQTGPQTSQSGTSSMSGPQQLMIPQTLAQQNRERPLLLEEQPLLLQDLLD
  QERQEQQQQRQMQAMIRQRSEPFFPNIDFDAITDPIMKAKMVALKGINKVMAQNNLGMPP
  MVMSRFPFMGQVVTGTQNSEGQNLGPQAIPQDGSITHQISRPNPPNFGPGFVNDSQRKQY
  EEWLQETQQLLQMQQKYLEEQIGAHRKSKKALSAKQRTAKKAGREFPEEDAEQLKHVTEQ
  QSMVQKQLEQIRKQQKEHAELIEDYRIKQQQQCAMAPPTMMPSVQPQPPLIPGATPPTMS
  QPTFPMVPQQLQHQQHTTVISGHTSPVRMPSLPGWQPNSAPAHLPLNPPRIQPPIAQLPI
  KTCTPAPGTVSNANPQSGPPPRVEFDDNNPFSESFQERERKERLREQQERQRIQLMQEVD
  RQRALQQRMEMEQHGMVGSEISSSRTSVSQIPFYSSDLPCDFMQPLGPLQQSPQHQQQMG
  QVLQQQNIQQGSINSPSTQTFMQTNERRQVGPPSFVPDSPSIPVGSPNFSSVKQGHGNLS
  GTSFQQSPVRPSFTPALPAAPPVANSSLPCGQDSTITHGHSYPGSTQSLIQLYSDIIPEE
  KGKKKRTRKKKRDDDAESTKAPSTPHSDITAPPTPGISETTSTPAVSTPSELPQQADQES
  VEPVGPSTPNMAAGQLCTELENKLPNSDFSQATPNQQTYANSEVDKLSMETPAKTEEIKL
  EKAETESCPGQEEPKLEEQNGSKVEGNAVACPVSSAQSPPHSAGAPAAKGDSGNELLKHL
  LKNKKSSSLLNQKPEGSICSEDDCTKDNKLVEKQNPAEGLQTLGAQMQGGFGCGNQLPKT
  DGGSETKKQRSKRTQRTGEKAAPRSKKRKKDEEEKQAMYSSTDTFTHLKQQNNLSNPPTP
  PASLPPTPPPMACQKMANGFATTEELAGKAGVLVSHEVTKTLGPKPFQLPFRPQDDLLAR
  ALAQGPKTVDVPASLPTPPHNNQEELRIQDHCGDRDTPDSFVPSSSPESVVGVEVSRYPD
  LSLVKEEPPEPVPSPIIPILPSTAGKSSESRRNDIKTEPGTLYFASPFGPSPNGPRSGLI
  SVAITLHPTAAENISSVVAAFSDLLHVRIPNSYEVSSAPDVPSMGLVSSHRINPGLEYRQ
  HLLLRGPPPGSANPPRLVSSYRLKQPNVPFPPTSNGLSGYKDSSHGIAESAALRPQWCCH
  CKVVILGSGVRKSFKDLTLLNKDSRESTKRVEKDIVFCSNNCFILYSSTAQAKNSENKES
  IPSLPQSPMRETPSKAFHQYSNNISTLDVHCLPQLPEKASPPASPPIAFPPAFEAAQVEA
  KPDELKVTVKLKPRLRAVHGGFEDCRPLNKKWRGMKWKKWSIHIVIPKGTFKPPCEDEID
  EFLKKLGTSLKPDPVPKDYRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVY
  ETQAGALINVELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCAIKAQCMFFKDKT
  MLCPMHKPKGIHEQELSYFAVFRRVYVQRDEVRQIASIVQRGERDHTFRVGSLIFHTIGQ
  LLPQQMQAFHSPKALFPVGYEASRLYWSTRYANRRCRYLCSIEEKDGRPVFVIRIVEQGH
  EDLVLSDISPKGVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIAESLPG
  VEACENYTFRYGRNPLMELPLAVNPTGCARSEPKMSAHVKRFVLRPHTLNSTSTSKSFQS
  TVTGELNAPYSKQFVHSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEY
  IGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVV
  TFERGHKIIISSSRRIQKGEELCYDYKFDFEDDQHKIPCHCGAVNCRKWMN
• Function: Histone methyltransferase that catalyzes methyl group transfer from S-adenosyl-L-methionine to the epsilon-amino group of 'Lys-4' of histone H3 (H3K4). Part of chromatin remodeling machinery predominantly forms H3K4me1 methylation marks at active chromatin sites where transcription and DNA repair take place. Likely plays a redundant role with KMT2D in enriching H3K4me1 mark on primed and active enhancer elements.
• Tissue Specificity: Highly expressed in testis and ovary, followed by brain and liver. Also expressed in placenta, peripherical blood, fetal thymus, heart, lung and kidney. Within brain, expression was highest in hippocampus, caudate nucleus, and substantia nigra. Not detected in skeletal muscle and fetal liver.
• KEGG Pathway:
  Lysine degradation (hsa00310)
  Metabolic pathways (hsa01100)
• Reactome Pathway:
  Activation of anterior HOX genes in hindbrain development during early embryogenesis (R-HSA-5617472)
  RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function (R-HSA-8936459)
  Formation of WDR5-containing histone-modifying complexes (R-HSA-9772755)
  PKMTs methylate histone lysines (R-HSA-3214841)
• BioCyc Pathway: MetaCyc:HS00685-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

44 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Estrogen-receptor positive breast cancer	DIS1H502	Definitive	Genetic Variation	[1]
Neurodevelopmental disorder	DIS372XH	Definitive	Biomarker	[2]
Syndromic intellectual disability	DISH7SDF	Definitive	Autosomal dominant	[3]
Acute lymphocytic leukaemia	DISPX75S	Strong	Biomarker	[4]
Acute myelogenous leukaemia	DISCSPTN	Strong	Genetic Variation	[5]
Adenocarcinoma	DIS3IHTY	Strong	Biomarker	[6]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[7]
Autism spectrum disorder	DISXK8NV	Strong	Biomarker	[8]
Bone osteosarcoma	DIST1004	Strong	Biomarker	[9]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[10]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[11]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Altered Expression	[12]
Endometrial cancer	DISW0LMR	Strong	Genetic Variation	[13]
Endometrial carcinoma	DISXR5CY	Strong	Genetic Variation	[13]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[14]
Gastric cancer	DISXGOUK	Strong	Genetic Variation	[15]
Gastric neoplasm	DISOKN4Y	Strong	Biomarker	[6]
Glioma	DIS5RPEH	Strong	Biomarker	[16]
Head and neck carcinoma	DISOU1DS	Strong	Biomarker	[17]
Hepatocellular carcinoma	DIS0J828	Strong	Genetic Variation	[18]
Hereditary diffuse gastric adenocarcinoma	DISUIBYS	Strong	Biomarker	[6]
Intellectual disability, autosomal dominant 40	DISAI0IH	Strong	Autosomal dominant	[19]
Kleefstra syndrome 2	DISD3NER	Strong	Autosomal dominant	[20]
leukaemia	DISS7D1V	Strong	Genetic Variation	[21]
Medulloblastoma	DISZD2ZL	Strong	Genetic Variation	[22]
Myelodysplastic syndrome	DISYHNUI	Strong	Biomarker	[23]
Neoplasm	DISZKGEW	Strong	Genetic Variation	[24]
Osteosarcoma	DISLQ7E2	Strong	Biomarker	[9]
Pancreatic tumour	DIS3U0LK	Strong	Biomarker	[25]
Prostate cancer	DISF190Y	Strong	Biomarker	[26]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[26]
Schizophrenia	DISSRV2N	Strong	Biomarker	[27]
Sezary syndrome	DISFMTC7	Strong	Biomarker	[28]
Stomach cancer	DISKIJSX	Strong	Genetic Variation	[15]
Intellectual disability	DISMBNXP	moderate	Biomarker	[8]
Nasopharyngeal carcinoma	DISAOTQ0	moderate	Biomarker	[7]
Cholangiocarcinoma	DIS71F6X	Limited	Biomarker	[29]
Intrahepatic cholangiocarcinoma	DIS6GOC8	Limited	Biomarker	[29]
Leukemia	DISNAKFL	Limited	Genetic Variation	[21]
Lung cancer	DISCM4YA	Limited	Biomarker	[30]
Lung carcinoma	DISTR26C	Limited	Biomarker	[30]
Transitional cell carcinoma	DISWVVDR	Limited	Biomarker	[31]
Urinary bladder cancer	DISDV4T7	Limited	Biomarker	[31]
Urinary bladder neoplasm	DIS7HACE	Limited	Biomarker	[31]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Histone-lysine N-methyltransferase 2C (KMT2C).	[32]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Histone-lysine N-methyltransferase 2C (KMT2C).	[48]

19 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Histone-lysine N-methyltransferase 2C (KMT2C).	[33]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Histone-lysine N-methyltransferase 2C (KMT2C).	[34]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Histone-lysine N-methyltransferase 2C (KMT2C).	[35]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Histone-lysine N-methyltransferase 2C (KMT2C).	[36]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Histone-lysine N-methyltransferase 2C (KMT2C).	[37]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Histone-lysine N-methyltransferase 2C (KMT2C).	[38]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Histone-lysine N-methyltransferase 2C (KMT2C).	[39]
Marinol	DM70IK5	Approved	Marinol increases the expression of Histone-lysine N-methyltransferase 2C (KMT2C).	[40]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Histone-lysine N-methyltransferase 2C (KMT2C).	[41]
Nicotine	DMWX5CO	Approved	Nicotine decreases the expression of Histone-lysine N-methyltransferase 2C (KMT2C).	[42]
Tubocurarine	DMBZIVP	Approved	Tubocurarine decreases the expression of Histone-lysine N-methyltransferase 2C (KMT2C).	[42]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Histone-lysine N-methyltransferase 2C (KMT2C).	[43]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate increases the expression of Histone-lysine N-methyltransferase 2C (KMT2C).	[44]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Histone-lysine N-methyltransferase 2C (KMT2C).	[45]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Histone-lysine N-methyltransferase 2C (KMT2C).	[46]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Histone-lysine N-methyltransferase 2C (KMT2C).	[47]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Histone-lysine N-methyltransferase 2C (KMT2C).	[37]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Histone-lysine N-methyltransferase 2C (KMT2C).	[49]
GALLICACID	DM6Y3A0	Investigative	GALLICACID decreases the expression of Histone-lysine N-methyltransferase 2C (KMT2C).	[50]

References

• [1] KMT2C mediates the estrogen dependence of breast cancer through regulation of ER enhancer function.Oncogene. 2018 Aug;37(34):4692-4710. doi: 10.1038/s41388-018-0273-5. Epub 2018 May 14.
• [2] Targeted sequencing identifies 91 neurodevelopmental-disorder risk genes with autism and developmental-disability biases. Nat Genet. 2017 Apr;49(4):515-526. doi: 10.1038/ng.3792. Epub 2017 Feb 13.
• [3] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [4] Excess congenital non-synonymous variation in leukemia-associated genes in MLL- infant leukemia: a Children's Oncology Group report.Leukemia. 2014 Jun;28(6):1235-41. doi: 10.1038/leu.2013.367. Epub 2013 Dec 4.
• [5] MLL-rearranged acute myeloid leukemia: Influence of the genetic partner in allo-HSCT response and prognostic factor of MLL 3' region mRNA expression.Eur J Haematol. 2018 May;100(5):436-443. doi: 10.1111/ejh.13037. Epub 2018 Mar 1.
• [6] Exome sequencing of gastric adenocarcinoma identifies recurrent somatic mutations in cell adhesion and chromatin remodeling genes.Nat Genet. 2012 May;44(5):570-4. doi: 10.1038/ng.2246.
• [7] SPLUNC1 and MLL3 regulate cancer stem cells in nasopharyngeal carcinoma.J BUON. 2019 Jul-Aug;24(4):1700-1705.
• [8] Functional convergence of histone methyltransferases EHMT1 and KMT2C involved in intellectual disability and autism spectrum disorder. PLoS Genet. 2017 Oct 25;13(10):e1006864. doi: 10.1371/journal.pgen.1006864. eCollection 2017 Oct.
• [9] KMT2C modulates migration and invasion processes in osteosarcoma cell lines.Pathol Res Pract. 2019 Oct;215(10):152534. doi: 10.1016/j.prp.2019.152534. Epub 2019 Jul 12.
• [10] Somatic mutations of the mixed-lineage leukemia 3 (MLL3) gene in primary breast cancers.Pathol Oncol Res. 2011 Jun;17(2):429-33. doi: 10.1007/s12253-010-9316-0. Epub 2010 Nov 30.
• [11] Contribution of rare germline copy number variations and common susceptibility loci in Lynch syndrome patients negative for mutations in the mismatch repair genes.Int J Cancer. 2016 Apr 15;138(8):1928-35. doi: 10.1002/ijc.29948. Epub 2015 Dec 28.
• [12] The Histone Methyltransferase Mixed Lineage Leukemia (MLL) 3 May Play a Potential Role on Clinical Dilated Cardiomyopathy.Mol Med. 2017 Oct;23:196-203. doi: 10.2119/molmed.2017.00012. Epub 2017 Aug 9.
• [13] Chromatin remodelling and DNA repair genes are frequently mutated in endometrioid endometrial carcinoma.Int J Cancer. 2017 Apr 1;140(7):1551-1563. doi: 10.1002/ijc.30573. Epub 2017 Feb 2.
• [14] MLL3 promotes the senescence of esophageal squamous cell carcinoma.Onco Targets Ther. 2019 Mar 1;12:1575-1582. doi: 10.2147/OTT.S187540. eCollection 2019.
• [15] A missense mutation (S3660L) in MLL3 gene influences risk of gastric cancer.J BUON. 2014 Apr-Jun;19(2):394-7.
• [16] EZH2-, CHD4-, and IDH-linked epigenetic perturbation and its association with survival in glioma patients.J Mol Cell Biol. 2017 Dec 1;9(6):477-488. doi: 10.1093/jmcb/mjx056.
• [17] Events of alternative splicing in head and neck cancer via RNA sequencing - an update.BMC Genomics. 2019 Jun 3;20(1):442. doi: 10.1186/s12864-019-5794-y.
• [18] A system for detecting high impact-low frequency mutations in primary tumors and metastases.Oncogene. 2018 Jan 11;37(2):185-196. doi: 10.1038/onc.2017.322. Epub 2017 Sep 11.
• [19] Histone Lysine Methylases and Demethylases in the Landscape of Human Developmental Disorders. Am J Hum Genet. 2018 Jan 4;102(1):175-187. doi: 10.1016/j.ajhg.2017.11.013. Epub 2017 Dec 21.
• [20] Disruption of an EHMT1-associated chromatin-modification module causes intellectual disability. Am J Hum Genet. 2012 Jul 13;91(1):73-82. doi: 10.1016/j.ajhg.2012.05.003. Epub 2012 Jun 21.
• [21] High-resolution genomic profiling of adult and pediatric core-binding factor acute myeloid leukemia reveals new recurrent genomic alterations.Blood. 2012 Mar 8;119(10):e67-75. doi: 10.1182/blood-2011-09-380444. Epub 2012 Jan 10.
• [22] The genetic landscape of the childhood cancer medulloblastoma.Science. 2011 Jan 28;331(6016):435-9. doi: 10.1126/science.1198056. Epub 2010 Dec 16.
• [23] Loss of Mll3 Catalytic Function Promotes Aberrant Myelopoiesis.PLoS One. 2016 Sep 9;11(9):e0162515. doi: 10.1371/journal.pone.0162515. eCollection 2016.
• [24] Gene alterations in epigenetic modifiers and JAK-STAT signaling are frequent in breast implant-associated ALCL.Blood. 2020 Jan 30;135(5):360-370. doi: 10.1182/blood.2019001904.
• [25] Whole-exome sequencing of pancreatic neoplasms with acinar differentiation.J Pathol. 2014 Mar;232(4):428-35. doi: 10.1002/path.4310.
• [26] The long tail of oncogenic drivers in prostate cancer.Nat Genet. 2018 May;50(5):645-651. doi: 10.1038/s41588-018-0078-z. Epub 2018 Apr 2.
• [27] Gene expression in superior temporal cortex of schizophrenia patients.Eur Arch Psychiatry Clin Neurosci. 2014 Jun;264(4):297-309. doi: 10.1007/s00406-013-0473-5. Epub 2013 Nov 28.
• [28] The mutational landscape of cutaneous T cell lymphoma and Szary syndrome.Nat Genet. 2015 Dec;47(12):1465-70. doi: 10.1038/ng.3442. Epub 2015 Nov 9.
• [29] Exome sequencing of liver fluke-associated cholangiocarcinoma.Nat Genet. 2012 May 6;44(6):690-3. doi: 10.1038/ng.2273.
• [30] RAS signaling and anti-RAS therapy: lessons learned from genetically engineered mouse models, human cancer cells, and patient-related studies.Acta Biochim Biophys Sin (Shanghai). 2016 Jan;48(1):27-38. doi: 10.1093/abbs/gmv090. Epub 2015 Sep 7.
• [31] Frequent mutations of chromatin remodeling genes in transitional cell carcinoma of the bladder.Nat Genet. 2011 Aug 7;43(9):875-8. doi: 10.1038/ng.907.
• [32] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [33] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [34] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [35] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [36] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [37] Genome-Wide Analysis of Low Dose Bisphenol-A (BPA) Exposure in Human Prostate Cells. Curr Genomics. 2019 May;20(4):260-274. doi: 10.2174/1389202920666190603123040.
• [38] Chronic occupational exposure to arsenic induces carcinogenic gene signaling networks and neoplastic transformation in human lung epithelial cells. Toxicol Appl Pharmacol. 2012 Jun 1;261(2):204-16.
• [39] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [40] Delta9-tetrahydrocannabinol inhibits cytotrophoblast cell proliferation and modulates gene transcription. Mol Hum Reprod. 2006 May;12(5):321-33. doi: 10.1093/molehr/gal036. Epub 2006 Apr 5.
• [41] Alcohol triggered bile acid disequilibrium by suppressing BSEP to sustain hepatocellular carcinoma progression. Chem Biol Interact. 2022 Apr 1;356:109847. doi: 10.1016/j.cbi.2022.109847. Epub 2022 Feb 9.
• [42] Nicotine modulates the expression of a diverse set of genes in the neuronal SH-SY5Y cell line. J Biol Chem. 2003 May 2;278(18):15633-40.
• [43] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [44] Epigallocatechin-3-gallate (EGCG) protects against chromate-induced toxicity in vitro. Toxicol Appl Pharmacol. 2012 Jan 15;258(2):166-75.
• [45] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [46] BET bromodomain inhibition as a novel strategy for reactivation of HIV-1. J Leukoc Biol. 2012 Dec;92(6):1147-54. doi: 10.1189/jlb.0312165. Epub 2012 Jul 16.
• [47] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [48] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [49] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [50] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.