Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCNZLSP)

DOT Name	Membrane protein MLC1 (MLC1)
Gene Name	MLC1
Related Disease	Amyotrophic lateral sclerosis ( ) Megalencephalic leukoencephalopathy with subcortical cysts 1 ( ) Acute lymphocytic leukaemia ( ) Acute myocardial infarction ( ) Arteriosclerosis ( ) Astrocytoma ( ) Atherosclerosis ( ) Cardiac arrest ( ) Cardiac failure ( ) Cardiovascular disease ( ) Chronic kidney disease ( ) Colitis ( ) Congestive heart failure ( ) Graft-versus-host disease ( ) Head and neck cancer ( ) Head and neck carcinoma ( ) Hepatocellular carcinoma ( ) Inflammatory bowel disease ( ) leukaemia ( ) Leukemia ( ) Leukodystrophy ( ) Lung neoplasm ( ) Mantle cell lymphoma ( ) Megalencephaly ( ) Myocardial infarction ( ) Neoplasm ( ) Non-small-cell lung cancer ( ) Optic neuritis ( ) Plasmodium vivax malaria ( ) Prostate cancer ( ) Prostate carcinoma ( ) Stroke ( ) Turner syndrome ( ) Ulcerative colitis ( ) Type-1 diabetes ( ) Megalencephalic leukoencephalopathy with subcortical cysts ( ) Acute myelogenous leukaemia ( ) Aortic valve stenosis ( ) Breast cancer ( ) Breast carcinoma ( ) Fabry disease ( )
UniProt ID	MLC1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MTQEPFREELAYDRMPTLERGRQDPASYAPDAKPSDLQLSKRLPPCFSHKTWVFSVLMGS CLLVTSGFSLYLGNVFPAEMDYLRCAAGSCIPSAIVSFTVSRRNANVIPNFQILFVSTFA VTTTCLIWFGCKLVLNPSAININFNLILLLLLELLMAATVIIAARSSEEDCKKKKGSMSD SANILDEVPFPARVLKSYSVVEVIAGISAVLGGIIALNVDDSVSGPHLSVTFFWILVACF PSAIASHVAAECPSKCLVEVLIAISSLTSPLLFTASGYLSFSIMRIVEMFKDYPPAIKPS YDVLLLLLLLVLLLQAGLNTGTAIQCVRFKVSARLQGASWDTQNGPQERLAGEVARSPLK EFDKEKAWRAVVVQMAQ
Function	Regulates the response of astrocytes to hypo-osmosis by promoting calcium influx.
Tissue Specificity	Expressed in the brain, with highest levels found in the amygdala, nucleus caudatus, thalamus and hippocampus.

Molecular Interaction Atlas (MIA) of This DOT

41 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Amyotrophic lateral sclerosis	DISF7HVM	Definitive	Biomarker	[1]
Megalencephalic leukoencephalopathy with subcortical cysts 1	DIS9VTJD	Definitive	Autosomal recessive	[2]
Acute lymphocytic leukaemia	DISPX75S	Strong	Biomarker	[3]
Acute myocardial infarction	DISE3HTG	Strong	Biomarker	[4]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[5]
Astrocytoma	DISL3V18	Strong	Biomarker	[6]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[5]
Cardiac arrest	DIS9DIA4	Strong	Biomarker	[7]
Cardiac failure	DISDC067	Strong	Biomarker	[8]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[5]
Chronic kidney disease	DISW82R7	Strong	Biomarker	[9]
Colitis	DISAF7DD	Strong	Altered Expression	[10]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[8]
Graft-versus-host disease	DIS0QADF	Strong	Biomarker	[11]
Head and neck cancer	DISBPSQZ	Strong	Biomarker	[12]
Head and neck carcinoma	DISOU1DS	Strong	Biomarker	[12]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[13]
Inflammatory bowel disease	DISGN23E	Strong	Altered Expression	[14]
leukaemia	DISS7D1V	Strong	Posttranslational Modification	[15]
Leukemia	DISNAKFL	Strong	Posttranslational Modification	[15]
Leukodystrophy	DISVY1TT	Strong	Genetic Variation	[16]
Lung neoplasm	DISVARNB	Strong	Biomarker	[17]
Mantle cell lymphoma	DISFREOV	Strong	Genetic Variation	[18]
Megalencephaly	DISYW5SV	Strong	Biomarker	[19]
Myocardial infarction	DIS655KI	Strong	Biomarker	[7]
Neoplasm	DISZKGEW	Strong	Biomarker	[20]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[21]
Optic neuritis	DISDYCHC	Strong	Biomarker	[22]
Plasmodium vivax malaria	DISPU3H9	Strong	Biomarker	[23]
Prostate cancer	DISF190Y	Strong	Biomarker	[24]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[24]
Stroke	DISX6UHX	Strong	Biomarker	[7]
Turner syndrome	DIS2035C	Strong	Genetic Variation	[25]
Ulcerative colitis	DIS8K27O	Strong	Genetic Variation	[26]
Type-1 diabetes	DIS7HLUB	moderate	Genetic Variation	[27]
Megalencephalic leukoencephalopathy with subcortical cysts	DISK9A1M	Supportive	Autosomal dominant	[28]
Acute myelogenous leukaemia	DISCSPTN	Limited	Biomarker	[29]
Aortic valve stenosis	DISW7AQ9	Limited	Biomarker	[30]
Breast cancer	DIS7DPX1	Limited	Biomarker	[31]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[31]
Fabry disease	DISUUQJF	Limited	Biomarker	[32]
------------------------------------------------------------------------------------


⏷ Show the Full List of 41 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Membrane protein MLC1 (MLC1).	[33]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Membrane protein MLC1 (MLC1).	[37]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Membrane protein MLC1 (MLC1).	[41]
------------------------------------------------------------------------------------

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Membrane protein MLC1 (MLC1).	[34]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Membrane protein MLC1 (MLC1).	[35]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Membrane protein MLC1 (MLC1).	[36]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Membrane protein MLC1 (MLC1).	[38]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Membrane protein MLC1 (MLC1).	[39]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Membrane protein MLC1 (MLC1).	[40]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Drug(s)

References

1	Elucidating the Contribution of Skeletal Muscle Ion Channels to Amyotrophic Lateral Sclerosis in search of new therapeutic options.Sci Rep. 2019 Feb 28;9(1):3185. doi: 10.1038/s41598-019-39676-3.
2	Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
3	Bone marrow transplantation for acute leukemia using a histocompatible paternal donor.Acta Haematol. 1979;61(2):80-4. doi: 10.1159/000207636.
4	Potential biomarkers of acute myocardial infarction based on weighted gene co-expression network analysis.Biomed Eng Online. 2019 Jan 25;18(1):9. doi: 10.1186/s12938-019-0625-6.
5	Quercetin-Induced AMP-Activated Protein Kinase Activation Attenuates Vasoconstriction Through LKB1-AMPK Signaling Pathway.J Med Food. 2018 Feb;21(2):146-153. doi: 10.1089/jmf.2017.4052. Epub 2017 Oct 16.
6	Megalencephalic Leukoencephalopathy with Subcortical Cysts Protein-1 (MLC1) Counteracts Astrocyte Activation in Response to Inflammatory Signals.Mol Neurobiol. 2019 Dec;56(12):8237-8254. doi: 10.1007/s12035-019-01657-y. Epub 2019 Jun 17.
7	Serum Bicarbonate Is Associated with Heart Failure in the Multi-Ethnic Study of Atherosclerosis.Am J Nephrol. 2017;45(2):118-126. doi: 10.1159/000454783. Epub 2016 Dec 10.
8	Depressed Myocardial Energetic Efficiency Increases Risk of Incident Heart Failure: The Strong Heart Study.J Clin Med. 2019 Jul 17;8(7):1044. doi: 10.3390/jcm8071044.
9	Cardiac Biomarkers and Cardiovascular Outcome in Children with Chronic Kidney Disease.Iran J Kidney Dis. 2019 Mar;13(2):120-128.
10	Aryl Hydrocarbon Receptor Activation Modulates Intestinal Epithelial Barrier Function by Maintaining Tight Junction Integrity.Int J Biol Sci. 2018 Jan 11;14(1):69-77. doi: 10.7150/ijbs.22259. eCollection 2018.
11	Transplantation of HLA-haploidentical T-cell-depleted marrow for leukemia: addition of cytosine arabinoside to the pretransplant conditioning prevents rejection.Exp Hematol. 1985 Dec;13(11):1201-10.
12	Automatic replanning of VMAT plans for different treatment machines: Atemplate-based approach using constrained optimization.Strahlenther Onkol. 2018 Oct;194(10):921-928. doi: 10.1007/s00066-018-1319-x. Epub 2018 May 30.
13	Deleted in liver cancer 1 (DLC1) negatively regulates Rho/ROCK/MLC pathway in hepatocellular carcinoma.PLoS One. 2008 Jul 23;3(7):e2779. doi: 10.1371/journal.pone.0002779.
14	Effects and Mechanism of Constitutive TL1A Expression on Intestinal Mucosal Barrier in DSS-Induced Colitis.Dig Dis Sci. 2019 Jul;64(7):1844-1856. doi: 10.1007/s10620-019-05580-z. Epub 2019 Apr 4.
15	Triptolide induces apoptosis in human leukemia cells through caspase-3-mediated ROCK1 activation and MLC phosphorylation.Cell Death Dis. 2013 Dec 5;4(12):e941. doi: 10.1038/cddis.2013.469.
16	Genome sequencing uncovers phenocopies in primary progressive multiple sclerosis.Ann Neurol. 2018 Jul;84(1):51-63. doi: 10.1002/ana.25263. Epub 2018 Jul 3.
17	An experimentally validated couch and MLC tracking simulator used to investigate hybrid couch-MLC tracking.Med Phys. 2017 Mar;44(3):798-809. doi: 10.1002/mp.12104.
18	Cell cycle alterations in the blastoid variant of mantle cell lymphoma (MCL-BV) as detected by gene expression profiling of mantle cell lymphoma (MCL) and MCL-BV.Diagn Mol Pathol. 2003 Mar;12(1):35-43. doi: 10.1097/00019606-200303000-00005.
19	Megalencephalic leukoencephalopathy with cysts: the Glialcam-null mouse model.Ann Clin Transl Neurol. 2017 Jun 6;4(7):450-465. doi: 10.1002/acn3.405. eCollection 2017 Jul.
20	Evaluating a potential technique with local optical flow vectors for automatic organ-at-risk (OAR) intrusion detection and avoidance during radiotherapy.Phys Med Biol. 2019 Jul 16;64(14):145008. doi: 10.1088/1361-6560/ab2db4.
21	DEK depletion negatively regulates Rho/ROCK/MLC pathway in non-small cell lung cancer.J Histochem Cytochem. 2013 Jul;61(7):510-21. doi: 10.1369/0022155413488120. Epub 2013 Apr 9.
22	Relation between Genetic markers and oligoclonal IgG in CSF in optic neuritis.J Neurol Sci. 1976 Jan;27(1):93-8. doi: 10.1016/0022-510x(76)90237-9.
23	Trials for the co-expression of the merozoite surface protein-1 and circumsporozoite protein genes of Plasmodium vivax.Exp Parasitol. 2011 Nov;129(3):227-33. doi: 10.1016/j.exppara.2011.08.014. Epub 2011 Aug 28.
24	Volumetric modulated arc therapy with dynamic collimator rotation for improved multileaf collimator tracking of the prostate.Radiother Oncol. 2017 Jan;122(1):109-115. doi: 10.1016/j.radonc.2016.11.004. Epub 2016 Nov 28.
25	Megalencephalic leukoencephalopathy with subcortical cysts without macrocephaly: A case study of comorbid Turner's syndrome.Clin Neurol Neurosurg. 2019 Sep;184:105400. doi: 10.1016/j.clineuro.2019.105400. Epub 2019 Jul 4.
26	HLA antigens and ulcerative colitis in Japan.Digestion. 1977;15(4):286-94. doi: 10.1159/000198014.
27	Genomic HLA-DQ beta polymorphism associated with insulin-dependent diabetes mellitus. Analysis of possible functional significance.Scand J Immunol. 1987 Mar;25(3):235-43. doi: 10.1111/j.1365-3083.1987.tb01069.x.
28	Megalencephalic Leukoencephalopathy with Subcortical Cysts. 2003 Aug 11 [updated 2023 Jul 27]. In: Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE, Bean LJH, Gripp KW, Amemiya A, editors. GeneReviews(?) [Internet]. Seattle (WA): University of Washington, Seattle; 1993C2024.
29	Rho kinase regulates the survival and transformation of cells bearing oncogenic forms of KIT, FLT3, and BCR-ABL.Cancer Cell. 2011 Sep 13;20(3):357-69. doi: 10.1016/j.ccr.2011.07.016.
30	Better Myocardial Function in Aortic Stenosis with Low Left Ventricular Mass: A Mechanism of Protection against Heart Failure Regardless of Stenosis Severity?.J Clin Med. 2019 Nov 1;8(11):1836. doi: 10.3390/jcm8111836.
31	ROCK isoforms differentially modulate cancer cell motility by mechanosensing the substrate stiffness.Acta Biomater. 2019 Apr 1;88:86-101. doi: 10.1016/j.actbio.2019.02.015. Epub 2019 Feb 13.
32	Insight into hypertrophied hearts: a cardiovascular magnetic resonance study of papillary muscle mass and T1 mapping.Eur Heart J Cardiovasc Imaging. 2017 Sep 1;18(9):1034-1040. doi: 10.1093/ehjci/jew187.
33	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
34	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
35	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
36	Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
37	Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
38	Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
39	Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
40	JunD is involved in the antiproliferative effect of Delta9-tetrahydrocannabinol on human breast cancer cells. Oncogene. 2008 Aug 28;27(37):5033-44.
41	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.