Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDXIAGG)

DOT Name Large ribosomal subunit protein mL65 (MRPS30)
Synonyms 39S ribosomal protein S30, mitochondrial; MRP-S30; S30mt; Large ribosomal subunit protein mS30; Programmed cell death protein 9
Gene Name MRPS30
Related Disease
Bacteremia ( )
Obstructive sleep apnea ( )
Parkinson disease ( )
Acute pyelonephritis ( )
Adenocarcinoma in situ ( )
Adult glioblastoma ( )
Androgen insensitivity syndrome ( )
Arrhythmia ( )
Atrial fibrillation ( )
Autosomal dominant optic atrophy, classic form ( )
Breast cancer ( )
Breast carcinoma ( )
Cervical cancer ( )
Cervical carcinoma ( )
Classic Hodgkin lymphoma ( )
Colitis ( )
Dysplasia of cervix ( )
Estrogen-receptor positive breast cancer ( )
Glioblastoma multiforme ( )
Hepatitis B virus infection ( )
Huntington disease ( )
leukaemia ( )
Leukemia ( )
Male infertility ( )
Obesity ( )
Pancreatic cancer ( )
Post-traumatic stress disorder ( )
Precancerous condition ( )
Pyelonephritis ( )
Scleroderma ( )
Severe combined immunodeficiency ( )
Sleep apnea syndrome ( )
Systemic lupus erythematosus ( )
Systemic sclerosis ( )
Type-1/2 diabetes ( )
Cervical Intraepithelial neoplasia ( )
Cholangiocarcinoma ( )
Methicillin-resistant staphylococci infection ( )
Pulmonary emphysema ( )
Breast neoplasm ( )
Neoplasm ( )
Amyotrophic lateral sclerosis ( )
Chronic obstructive pulmonary disease ( )
Colorectal carcinoma ( )
Human papillomavirus infection ( )
Pancreatitis ( )
Psychotic disorder ( )
UniProt ID
RT30_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
3J7Y ; 3J9M ; 5OOL ; 5OOM ; 6I9R ; 6NU2 ; 6NU3 ; 6VLZ ; 6VMI ; 6ZM5 ; 6ZM6 ; 6ZS9 ; 6ZSA ; 6ZSB ; 6ZSC ; 6ZSD ; 6ZSE ; 6ZSG ; 7A5F ; 7A5G ; 7A5H ; 7A5I ; 7A5J ; 7A5K ; 7L08 ; 7L20 ; 7O9K ; 7O9M ; 7ODR ; 7ODS ; 7ODT ; 7OF0 ; 7OF2 ; 7OF3 ; 7OF4 ; 7OF5 ; 7OF6 ; 7OF7 ; 7OG4 ; 7OI6 ; 7OI7 ; 7OI8 ; 7OI9 ; 7OIA ; 7OIB ; 7OIC ; 7OID ; 7OIE ; 7PD3 ; 7PO4 ; 7QH6 ; 7QH7 ; 7QI4 ; 7QI5 ; 7QI6 ; 8ANY ; 8OIR ; 8OIT
Pfam ID
PF07147
Sequence
MAAARCWRPLLRGPRLSLHTAANAAATATETTCQDVAATPVARYPPIVASMTADSKAARL
RRIERWQATVHAAESVDEKLRILTKMQFMKYMVYPQTFALNADRWYQYFTKTVFLSGLPP
PPAEPEPEPEPEPEPALDLAALRAVACDCLLQEHFYLRRRRRVHRYEESEVISLPFLDQL
VSTLVGLLSPHNPALAAAALDYRCPVHFYWVRGEEIIPRGHRRGRIDDLRYQIDDKPNNQ
IRISKQLAEFVPLDYSVPIEIPTIKCKPDKLPLFKRQYENHIFVGSKTADPCCYGHTQFH
LLPDKLRRERLLRQNCADQIEVVFRANAIASLFAWTGAQAMYQGFWSEADVTRPFVSQAV
ITDGKYFSFFCYQLNTLALTTQADQNNPRKNICWGTQSKPLYETIEDNDVKGFNDDVLLQ
IVHFLLNRPKEEKSQLLEN
Tissue Specificity Heart, skeletal muscle, kidney and liver. Lower expression in placenta and peripheral blood leukocytes.
Reactome Pathway
Mitochondrial translation elongation (R-HSA-5389840 )
Mitochondrial translation termination (R-HSA-5419276 )
Mitochondrial translation initiation (R-HSA-5368286 )

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Bacteremia DIS6N9RZ Definitive Biomarker [1]
Obstructive sleep apnea DIS0SVD1 Definitive Biomarker [2]
Parkinson disease DISQVHKL Definitive Biomarker [3]
Acute pyelonephritis DISLG5PR Strong Genetic Variation [4]
Adenocarcinoma in situ DISSTE29 Strong Biomarker [5]
Adult glioblastoma DISVP4LU Strong Biomarker [6]
Androgen insensitivity syndrome DISUZBBO Strong Biomarker [5]
Arrhythmia DISFF2NI Strong Biomarker [7]
Atrial fibrillation DIS15W6U Strong Biomarker [7]
Autosomal dominant optic atrophy, classic form DISXUAV9 Strong Biomarker [8]
Breast cancer DIS7DPX1 Strong Genetic Variation [9]
Breast carcinoma DIS2UE88 Strong Genetic Variation [9]
Cervical cancer DISFSHPF Strong Biomarker [10]
Cervical carcinoma DIST4S00 Strong Biomarker [10]
Classic Hodgkin lymphoma DISV1LU6 Strong Biomarker [11]
Colitis DISAF7DD Strong Biomarker [12]
Dysplasia of cervix DISOAROS Strong Genetic Variation [13]
Estrogen-receptor positive breast cancer DIS1H502 Strong Genetic Variation [14]
Glioblastoma multiforme DISK8246 Strong Biomarker [6]
Hepatitis B virus infection DISLQ2XY Strong Biomarker [15]
Huntington disease DISQPLA4 Strong Biomarker [11]
leukaemia DISS7D1V Strong Altered Expression [16]
Leukemia DISNAKFL Strong Genetic Variation [16]
Male infertility DISY3YZZ Strong Altered Expression [17]
Obesity DIS47Y1K Strong Biomarker [18]
Pancreatic cancer DISJC981 Strong Biomarker [19]
Post-traumatic stress disorder DISHL1EY Strong Biomarker [20]
Precancerous condition DISV06FL Strong Biomarker [21]
Pyelonephritis DISAOX93 Strong Biomarker [22]
Scleroderma DISVQ342 Strong Biomarker [23]
Severe combined immunodeficiency DIS6MF4Q Strong Biomarker [16]
Sleep apnea syndrome DISER6KS Strong Biomarker [24]
Systemic lupus erythematosus DISI1SZ7 Strong Biomarker [25]
Systemic sclerosis DISF44L6 Strong Biomarker [23]
Type-1/2 diabetes DISIUHAP Strong Genetic Variation [18]
Cervical Intraepithelial neoplasia DISXP757 moderate Genetic Variation [13]
Cholangiocarcinoma DIS71F6X moderate Genetic Variation [26]
Methicillin-resistant staphylococci infection DIS6DRDZ moderate Biomarker [27]
Pulmonary emphysema DIS5M7HZ moderate Biomarker [26]
Breast neoplasm DISNGJLM Disputed Genetic Variation [14]
Neoplasm DISZKGEW Disputed Biomarker [28]
Amyotrophic lateral sclerosis DISF7HVM Limited Biomarker [29]
Chronic obstructive pulmonary disease DISQCIRF Limited Biomarker [30]
Colorectal carcinoma DIS5PYL0 Limited Genetic Variation [31]
Human papillomavirus infection DISX61LX Limited Genetic Variation [32]
Pancreatitis DIS0IJEF Limited Altered Expression [19]
Psychotic disorder DIS4UQOT Limited Biomarker [33]
------------------------------------------------------------------------------------
⏷ Show the Full List of 47 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Large ribosomal subunit protein mL65 (MRPS30). [34]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Large ribosomal subunit protein mL65 (MRPS30). [35]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Large ribosomal subunit protein mL65 (MRPS30). [36]
Ivermectin DMDBX5F Approved Ivermectin increases the expression of Large ribosomal subunit protein mL65 (MRPS30). [37]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Large ribosomal subunit protein mL65 (MRPS30). [38]
Irinotecan DMP6SC2 Approved Irinotecan decreases the expression of Large ribosomal subunit protein mL65 (MRPS30). [39]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of Large ribosomal subunit protein mL65 (MRPS30). [41]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Large ribosomal subunit protein mL65 (MRPS30). [40]
------------------------------------------------------------------------------------

References

1 In vivo-generated thrombin and plasmin do not activate the complement system in baboons.Blood. 2017 Dec 14;130(24):2678-2681. doi: 10.1182/blood-2017-06-788216. Epub 2017 Oct 11.
2 Polysomnographic determinants of requirement for advanced positive pressure therapeutic options for obstructive sleep apnea.Sleep Breath. 2018 May;22(2):401-409. doi: 10.1007/s11325-017-1556-8. Epub 2017 Aug 18.
3 Treating sleep apnea in Parkinson's disease with C-PAP: feasibility concerns and effects on cognition and alertness.Sleep Med. 2017 May;33:114-118. doi: 10.1016/j.sleep.2017.01.009. Epub 2017 Jan 27.
4 Sequence microdiversity at the ribosomal RNA operons of Escherichia coli pyelonephritogenic strains.Clin Microbiol Infect. 2001 Jul;7(7):345-51. doi: 10.1046/j.1198-743x.2001.00260.x.
5 Human papillomavirus (HPV) test and PAP smear as predictors of outcome in conservatively treated adenocarcinoma in situ (AIS) of the uterine cervix.Gynecol Oncol. 2007 Jul;106(1):170-6. doi: 10.1016/j.ygyno.2007.03.016. Epub 2007 May 4.
6 The HIF-2alpha dependent induction of PAP and adenosine synthesis regulates glioblastoma stem cell function through the A2B adenosine receptor.Int J Biochem Cell Biol. 2014 Apr;49:8-16. doi: 10.1016/j.biocel.2014.01.007. Epub 2014 Jan 13.
7 Improvement in Sleep-Disordered Breathing Indices Downloaded From a Positive Airway Pressure Machine Following Conversion of Atrial Fibrillation to Sinus Rhythm.J Clin Sleep Med. 2018 Nov 15;14(11):1953-1957. doi: 10.5664/jcsm.7502.
8 Facilitating physical activity and reducing symptoms in patients with knee osteoarthritis: study protocol of a randomized controlled trial to test a theory-based PrevOP-psychological adherence program (PrevOP-PAP).BMC Musculoskelet Disord. 2018 Jul 18;19(1):221. doi: 10.1186/s12891-018-2158-8.
9 Integrative Genomic Analysis Predicts Causative Cis-Regulatory Mechanisms of the Breast Cancer-Associated Genetic Variant rs4415084.Cancer Res. 2018 Apr 1;78(7):1579-1591. doi: 10.1158/0008-5472.CAN-17-3486. Epub 2018 Jan 19.
10 Early diagnosis behavior in Turkish women with and without a family history of cervical cancer.Asian Pac J Cancer Prev. 2015;16(2):401-6. doi: 10.7314/apjcp.2015.16.2.401.
11 Infrainguinal bypass surgery outcomes are worse in hemodialysis patients compared with patients with renal transplants.J Vasc Surg. 2019 Mar;69(3):850-856. doi: 10.1016/j.jvs.2018.05.252. Epub 2018 Dec 21.
12 Oral delivery of pancreatitis-associated protein by Lactococcus lactis displays protective effects in dinitro-benzenesulfonic-acid-induced colitis model and is able to modulate the composition of the microbiota.Environ Microbiol. 2019 Nov;21(11):4020-4031. doi: 10.1111/1462-2920.14748. Epub 2019 Sep 10.
13 Adherence to gynecological screening impacted by experienced orthodontic treatment in childhood.Arch Gynecol Obstet. 2019 Jan;299(1):167-171. doi: 10.1007/s00404-018-4950-y. Epub 2018 Oct 30.
14 Evidence that the 5p12 Variant rs10941679 Confers Susceptibility to Estrogen-Receptor-Positive Breast Cancer through FGF10 and MRPS30 Regulation.Am J Hum Genet. 2016 Oct 6;99(4):903-911. doi: 10.1016/j.ajhg.2016.07.017. Epub 2016 Sep 15.
15 Inhibition of hepatitis B virus replication by pokeweed antiviral protein in vitro.World J Gastroenterol. 2008 Mar 14;14(10):1592-7. doi: 10.3748/wjg.14.1592.
16 Effective immunochemotherapy of human t(4;11) leukemia in mice with severe combined immunodeficiency (SCID) using B43 (anti-CD19)-pokeweed antiviral protein immunotoxin plus cyclophosphamide.Leukemia. 1993 Feb;7(2):290-7.
17 MiR-125b-2 Knockout in Testis Is Associated with Targeting to the PAP Gene, Mitochondrial Copy Number, and Impaired Sperm Quality.Int J Mol Sci. 2019 Jan 3;20(1):148. doi: 10.3390/ijms20010148.
18 Mutations in MKKS cause Bardet-Biedl syndrome.Nat Genet. 2000 Sep;26(1):15-6. doi: 10.1038/79116.
19 PAP/REG3A favors perineural invasion in pancreatic adenocarcinoma and serves as a prognostic marker.Cell Mol Life Sci. 2017 Nov;74(22):4231-4243. doi: 10.1007/s00018-017-2579-9. Epub 2017 Jun 27.
20 Treatment of OSA with CPAP Is Associated with Improvement in PTSD Symptoms among Veterans.J Clin Sleep Med. 2017 Jan 15;13(1):57-63. doi: 10.5664/jcsm.6388.
21 Detection of HPV and ras gene mutations in cervical smears from female genital lesions.Oncol Rep. 1998 Sep-Oct;5(5):1195-8. doi: 10.3892/or.5.5.1195.
22 Characterization of adhesion associated surface properties of uropathogenic Escherichia coli.Folia Microbiol (Praha). 1994;39(5):373-7. doi: 10.1007/BF02814441.
23 Changes in pulmonary exercise haemodynamics in scleroderma: a 4-year prospective study.Eur Respir J. 2017 Jul 13;50(1):1601708. doi: 10.1183/13993003.01708-2016. Print 2017 Jul.
24 Economic Assessment of 4 Approaches to the Diagnosis and Initial Treatment of Sleep Apnea.Respir Care. 2018 Jan;63(1):50-61. doi: 10.4187/respcare.05355. Epub 2017 Oct 24.
25 Evaluation of pulmonary artery pressure in patients with juvenile systemic lupus erythematosus (jSLE).Bosn J Basic Med Sci. 2018 Feb 20;18(1):66-71. doi: 10.17305/bjbms.2017.2178.
26 Role for interleukin-6 in COPD-related pulmonary hypertension.Chest. 2009 Sep;136(3):678-687. doi: 10.1378/chest.08-2420. Epub 2009 Apr 6.
27 Screening for Intermediately Vancomycin-Susceptible and Vancomycin-Heteroresistant Staphylococcus aureus by Use of Vancomycin-Supplemented Brain Heart Infusion Agar Biplates: Defining Growth Interpretation Criteria Based on Gold Standard Confirmation.J Clin Microbiol. 2015 Nov;53(11):3543-6. doi: 10.1128/JCM.01620-15. Epub 2015 Aug 26.
28 Detection of high-grade neoplasia in air-dried cervical PAP smears by a microRNA-based classifier.Oncol Rep. 2018 Mar;39(3):1099-1111. doi: 10.3892/or.2018.6214. Epub 2018 Jan 12.
29 Associative Increases in Amyotrophic Lateral Sclerosis Survival Duration With Non-invasive Ventilation Initiation and Usage Protocols.Front Neurol. 2018 Jul 12;9:578. doi: 10.3389/fneur.2018.00578. eCollection 2018.
30 The evaluation of cardiac functions according to chronic obstructive pulmonary disease groups.Aging Male. 2020 Jun;23(2):106-111. doi: 10.1080/13685538.2019.1606191. Epub 2019 Apr 30.
31 Death from early colorectal cancer is predicted by the presence of transcripts of the REG gene family.Br J Cancer. 2000 Jul;83(2):188-95. doi: 10.1054/bjoc.2000.1227.
32 Prevalence of human papillomavirus infection in women in the Autonomous Region of Inner Mongolia: A population-based study of a Chinese ethnic minority.J Med Virol. 2018 Jan;90(1):148-156. doi: 10.1002/jmv.24888. Epub 2017 Oct 6.
33 Increased frequency of psychosis after second-generation antiepileptic drug administration in adults with focal epilepsy.Epilepsy Behav. 2019 Aug;97:138-143. doi: 10.1016/j.yebeh.2019.06.002. Epub 2019 Jun 25.
34 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
35 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
36 Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
37 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
38 Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
39 Clinical determinants of response to irinotecan-based therapy derived from cell line models. Clin Cancer Res. 2008 Oct 15;14(20):6647-55.
40 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
41 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.