Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGSG2PA)

• DOT Name: Centrosomal protein of 55 kDa (CEP55)
• Synonyms: Cep55; Up-regulated in colon cancer 6
• Gene Name: CEP55
• Related Disease:
  Adult glioblastoma
  Advanced cancer
  Benign prostatic hyperplasia
  Bladder cancer
  Bladder transitional cell carcinoma
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Cervical cancer
  Cervical carcinoma
  Ciliopathy
  Clear cell renal carcinoma
  Epithelial ovarian cancer
  Esophageal squamous cell carcinoma
  Gastric cancer
  Glioblastoma multiforme
  Glioma
  Head-neck squamous cell carcinoma
  Hydranencephaly
  Lung adenocarcinoma
  Lung cancer
  Lung carcinoma
  Multinucleated neurons-anhydramnios-renal dysplasia-cerebellar hypoplasia-hydranencephaly syndrome
  Non-insulin dependent diabetes
  Non-small-cell lung cancer
  NPHP3-related Meckel-like syndrome
  Pancreatic cancer
  Polycystic ovarian syndrome
  Prostate cancer
  Prostate carcinoma
  Renal cell carcinoma
  Renal dysplasia
  Stomach cancer
  T-cell lymphoma
  Tarsal-carpal coalition syndrome
  Transitional cell carcinoma
  Urinary bladder cancer
  Urinary bladder neoplasm
  Complex neurodevelopmental disorder
  Bone osteosarcoma
  Osteosarcoma
  Castration-resistant prostate carcinoma
  Colon cancer
  Colonic neoplasm
  Colorectal carcinoma
  Hepatocellular carcinoma
  Meckel syndrome
  Small lymphocytic lymphoma
• UniProt ID: CEP55_HUMAN
• PDB ID: 3E1R; 3WUT; 3WUU; 3WUV
• Pfam ID: PF12180
• Sequence:
  MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGKLTDKERHRLL
  EKIRVLEAEKEKNAYQLTEKDKEIQRLRDQLKARYSTTTLLEQLEETTREGERREQVLKA
  LSEEKDVLKQQLSAATSRIAELESKTNTLRLSQTVAPNCFNSSINNIHEMEIQLKDALEK
  NQQWLVYDQQREVYVKGLLAKIFELEKKTETAAHSLPQQTKKPESEGYLQEEKQKCYNDL
  LASAKKDLEVERQTITQLSFELSEFRRKYEETQKEVHNLNQLLYSQRRADVQHLEDDRHK
  TEKIQKLREENDIARGKLEEEKKRSEELLSQVQFLYTSLLKQQEEQTRVALLEQQMQACT
  LDFENEKLDRQHVQHQLHVILKELRKARNQITQLESLKQLHEFAITEPLVTFQGETENRE
  KVAASPKSPTAALNESLVECPKCNIQYPATEHRDLLVHVEYCSK
• Function: Plays a role in mitotic exit and cytokinesis. Recruits PDCD6IP and TSG101 to midbody during cytokinesis. Required for successful completion of cytokinesis. Not required for microtubule nucleation. Plays a role in the development of the brain and kidney.
• Tissue Specificity: Expressed in embryonic brain . Expressed in fetal brain ganglionic eminence, kidney tubules and multinucleate neurons in the temporal cortex . Expressed in adult brain, cerebellum, kidney tubules, intestine and muscles (at protein level) . Widely expressed, mostly in proliferative tissues. Highly expressed in testis. Intermediate levels in adult and fetal thymus, as well as in various cancer cell lines. Low levels in different parts of the digestive tract, bone marrow, lymph nodes, placenta, fetal heart and fetal spleen. Hardly detected in brain.

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[1]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[2]
Benign prostatic hyperplasia	DISI3CW2	Strong	Altered Expression	[3]
Bladder cancer	DISUHNM0	Strong	Altered Expression	[4]
Bladder transitional cell carcinoma	DISNL46A	Strong	Biomarker	[3]
Breast cancer	DIS7DPX1	Strong	Biomarker	[5]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[5]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[5]
Cervical cancer	DISFSHPF	Strong	Altered Expression	[6]
Cervical carcinoma	DIST4S00	Strong	Altered Expression	[6]
Ciliopathy	DIS10G4I	Strong	Biomarker	[7]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[2]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[8]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[9]
Gastric cancer	DISXGOUK	Strong	Biomarker	[10]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[1]
Glioma	DIS5RPEH	Strong	Biomarker	[11]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Altered Expression	[12]
Hydranencephaly	DISE02PO	Strong	Biomarker	[13]
Lung adenocarcinoma	DISD51WR	Strong	Altered Expression	[14]
Lung cancer	DISCM4YA	Strong	Biomarker	[15]
Lung carcinoma	DISTR26C	Strong	Biomarker	[15]
Multinucleated neurons-anhydramnios-renal dysplasia-cerebellar hypoplasia-hydranencephaly syndrome	DISUI3YD	Strong	Autosomal recessive	[16]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[17]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[15]
NPHP3-related Meckel-like syndrome	DIS2QQIV	Strong	Genetic Variation	[7]
Pancreatic cancer	DISJC981	Strong	Biomarker	[18]
Polycystic ovarian syndrome	DISZ2BNG	Strong	Biomarker	[19]
Prostate cancer	DISF190Y	Strong	Altered Expression	[20]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[20]
Renal cell carcinoma	DISQZ2X8	Strong	Altered Expression	[21]
Renal dysplasia	DIS3DFGD	Strong	Biomarker	[13]
Stomach cancer	DISKIJSX	Strong	Biomarker	[10]
T-cell lymphoma	DISSXRTQ	Strong	Altered Expression	[22]
Tarsal-carpal coalition syndrome	DISY90L2	Strong	Altered Expression	[3]
Transitional cell carcinoma	DISWVVDR	Strong	Altered Expression	[3]
Urinary bladder cancer	DISDV4T7	Strong	Altered Expression	[4]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[4]
Complex neurodevelopmental disorder	DISB9AFI	Moderate	Autosomal recessive	[23]
Bone osteosarcoma	DIST1004	Disputed	Biomarker	[24]
Osteosarcoma	DISLQ7E2	Disputed	Biomarker	[24]
Castration-resistant prostate carcinoma	DISVGAE6	Limited	Biomarker	[25]
Colon cancer	DISVC52G	Limited	Genetic Variation	[26]
Colonic neoplasm	DISSZ04P	Limited	Altered Expression	[26]
Colorectal carcinoma	DIS5PYL0	Limited	Altered Expression	[26]
Hepatocellular carcinoma	DIS0J828	Limited	Genetic Variation	[27]
Meckel syndrome	DISXPHOY	Limited	GermlineCausalMutation	[7]
Small lymphocytic lymphoma	DIS30POX	Limited	Biomarker	[28]

31 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Centrosomal protein of 55 kDa (CEP55).	[29]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Centrosomal protein of 55 kDa (CEP55).	[30]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Centrosomal protein of 55 kDa (CEP55).	[31]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Centrosomal protein of 55 kDa (CEP55).	[32]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Centrosomal protein of 55 kDa (CEP55).	[33]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Centrosomal protein of 55 kDa (CEP55).	[34]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Centrosomal protein of 55 kDa (CEP55).	[35]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Centrosomal protein of 55 kDa (CEP55).	[36]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Centrosomal protein of 55 kDa (CEP55).	[37]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Centrosomal protein of 55 kDa (CEP55).	[38]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Centrosomal protein of 55 kDa (CEP55).	[37]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Centrosomal protein of 55 kDa (CEP55).	[39]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Centrosomal protein of 55 kDa (CEP55).	[40]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Centrosomal protein of 55 kDa (CEP55).	[41]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Centrosomal protein of 55 kDa (CEP55).	[42]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Centrosomal protein of 55 kDa (CEP55).	[43]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Centrosomal protein of 55 kDa (CEP55).	[44]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of Centrosomal protein of 55 kDa (CEP55).	[45]
Methamphetamine	DMPM4SK	Approved	Methamphetamine decreases the expression of Centrosomal protein of 55 kDa (CEP55).	[46]
Palbociclib	DMD7L94	Approved	Palbociclib decreases the expression of Centrosomal protein of 55 kDa (CEP55).	[47]
GSK2110183	DMZHB37	Phase 2	GSK2110183 decreases the expression of Centrosomal protein of 55 kDa (CEP55).	[48]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Centrosomal protein of 55 kDa (CEP55).	[49]
TAK-114	DMTXE19	Phase 1	TAK-114 decreases the expression of Centrosomal protein of 55 kDa (CEP55).	[50]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Centrosomal protein of 55 kDa (CEP55).	[51]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Centrosomal protein of 55 kDa (CEP55).	[52]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Centrosomal protein of 55 kDa (CEP55).	[53]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Centrosomal protein of 55 kDa (CEP55).	[34]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Centrosomal protein of 55 kDa (CEP55).	[54]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Centrosomal protein of 55 kDa (CEP55).	[55]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Centrosomal protein of 55 kDa (CEP55).	[56]
Dibutyl phthalate	DMEDGKO	Investigative	Dibutyl phthalate increases the expression of Centrosomal protein of 55 kDa (CEP55).	[50]

References

• [1] Identification of Potential Biomarkers in Glioblastoma through Bioinformatic Analysis and Evaluating Their Prognostic Value.Biomed Res Int. 2019 Apr 15;2019:6581576. doi: 10.1155/2019/6581576. eCollection 2019.
• [2] Diagnostic and prognostic value of CEP55 in clear cell renal cell carcinoma as determined by bioinformatics analysis.Mol Med Rep. 2019 May;19(5):3485-3496. doi: 10.3892/mmr.2019.10042. Epub 2019 Mar 15.
• [3] Expression and clinical significance of Centrosomal protein 55 (CEP55) in human urinary bladder transitional cell carcinoma.Immunobiology. 2015 Jan;220(1):103-8. doi: 10.1016/j.imbio.2014.08.014. Epub 2014 Aug 21.
• [4] Assessment of CEP55, PLK1 and FOXM1 expression in patients with bladder cancer in comparison with healthy individuals.Cancer Invest. 2018;36(8):407-414. doi: 10.1080/07357907.2018.1514504. Epub 2018 Oct 2.
• [5] MiR-144 suppresses proliferation, invasion, and migration of breast cancer cells through inhibiting CEP55.Cancer Biol Ther. 2018 Apr 3;19(4):306-315. doi: 10.1080/15384047.2017.1416934. Epub 2018 Mar 26.
• [6] High levels of centrosomal protein 55 expression is associated with poor clinical prognosis in patients with cervical cancer.Oncol Lett. 2018 Jun;15(6):9347-9352. doi: 10.3892/ol.2018.8448. Epub 2018 Apr 10.
• [7] A nonsense mutation in CEP55 defines a new locus for a Meckel-like syndrome, an autosomal recessive lethal fetal ciliopathy.Clin Genet. 2017 Nov;92(5):510-516. doi: 10.1111/cge.13012. Epub 2017 May 3.
• [8] Upregulation of centrosomal protein 55 is associated with unfavorable prognosis and tumor invasion in epithelial ovarian carcinoma.Tumour Biol. 2016 May;37(5):6239-54. doi: 10.1007/s13277-015-4419-6. Epub 2015 Nov 28.
• [9] Integrated analysis of differentially expressed genes in esophageal squamous cell carcinoma using bioinformatics.Neoplasma. 2018;65(4):523-531. doi: 10.4149/neo_2018_170708N470.
• [10] CEP55 contributes to human gastric carcinoma by regulating cell proliferation.Tumour Biol. 2014 May;35(5):4389-99. doi: 10.1007/s13277-013-1578-1. Epub 2014 Jan 4.
• [11] CEP55 promoted the migration, invasion and neuroshpere formation of the glioma cell line U251.Neurosci Lett. 2019 Jul 13;705:80-86. doi: 10.1016/j.neulet.2019.04.038. Epub 2019 Apr 18.
• [12] Downstream targets of FOXM1: CEP55 and HELLS are cancer progression markers of head and neck squamous cell carcinoma.Oral Oncol. 2010 Jul;46(7):536-42. doi: 10.1016/j.oraloncology.2010.03.022. Epub 2010 Apr 18.
• [13] An Amish founder variant consolidates disruption of CEP55 as a cause of hydranencephaly and renal dysplasia.Eur J Hum Genet. 2019 Apr;27(4):657-662. doi: 10.1038/s41431-018-0306-0. Epub 2019 Jan 8.
• [14] Correlation between EZH2 and CEP55 and lung adenocarcinoma prognosis.Pathol Res Pract. 2019 Feb;215(2):292-301. doi: 10.1016/j.prp.2018.11.016. Epub 2018 Nov 24.
• [15] High CEP55 expression is associated with poor prognosis in non-small-cell lung cancer.Onco Targets Ther. 2018 Aug 17;11:4979-4990. doi: 10.2147/OTT.S165750. eCollection 2018.
• [16] [Congress discussion on EEC-directives for nurses: nurses in EEC interested in the development of nursing]. Sygeplejersken. 1978 May 31;78(21):8-9.
• [17] Comparison of therapeutic effects of acarbose and metformin under different -cell function status in Chinese patients with type 2 diabetes.Endocr J. 2019 May 28;66(5):443-450. doi: 10.1507/endocrj.EJ18-0466. Epub 2019 Apr 2.
• [18] Centrosomal protein 55 activates NF-B signalling and promotes pancreatic cancer cells aggressiveness.Sci Rep. 2017 Jul 19;7(1):5925. doi: 10.1038/s41598-017-06132-z.
• [19] Progesterone resistance in PCOS endometrium: a microarray analysis in clomiphene citrate-treated and artificial menstrual cycles.J Clin Endocrinol Metab. 2011 Jun;96(6):1737-46. doi: 10.1210/jc.2010-2600. Epub 2011 Mar 16.
• [20] MicroRNA-144-3p inhibits cell proliferation and induces cell apoptosis in prostate cancer by targeting CEP55.Am J Transl Res. 2018 Aug 15;10(8):2457-2468. eCollection 2018.
• [21] CEP55 promotes epithelial-mesenchymal transition in renal cell carcinoma through PI3K/AKT/mTOR pathway.Clin Transl Oncol. 2019 Jul;21(7):939-949. doi: 10.1007/s12094-018-02012-8. Epub 2019 Jan 3.
• [22] Expression and clinical significance of centrosomal protein 55 in T-cell lymphoma.J Cancer Res Ther. 2018 Jan;14(1):94-98. doi: 10.4103/jcrt.JCRT_758_17.
• [23] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [24] CEP55 promotes the proliferation and invasion of tumour cells via the AKT signalling pathway in osteosarcoma.Carcinogenesis. 2018 Apr 5;39(4):623-631. doi: 10.1093/carcin/bgy017.
• [25] MicroRNA-144-3p inhibits cell proliferation and promotes apoptosis in castration-resistant prostate cancer by targeting CEP55.Eur Rev Med Pharmacol Sci. 2018 Nov;22(22):7660-7670. doi: 10.26355/eurrev_201811_16383.
• [26] Elevated expression of C10orf3 (chromosome 10 open reading frame 3) is involved in the growth of human colon tumor.Oncogene. 2006 Jan 19;25(3):480-6. doi: 10.1038/sj.onc.1209051.
• [27] Bioinformatics analysis of the interactions among lncRNA, miRNA and mRNA expression, genetic mutations and epigenetic modifications in hepatocellular carcinoma.Mol Med Rep. 2019 Feb;19(2):1356-1364. doi: 10.3892/mmr.2018.9728. Epub 2018 Dec 5.
• [28] Mitotic slippage: an old tale with a new twist.Cell Cycle. 2019 Jan;18(1):7-15. doi: 10.1080/15384101.2018.1559557. Epub 2019 Jan 2.
• [29] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [30] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [31] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [32] RNA sequence analysis of inducible pluripotent stem cell-derived cardiomyocytes reveals altered expression of DNA damage and cell cycle genes in response to doxorubicin. Toxicol Appl Pharmacol. 2018 Oct 1;356:44-53.
• [33] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [34] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [35] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [36] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [37] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [38] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [39] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [40] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [41] Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
• [42] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [43] Effects of acute ethanol treatment on NCCIT cells and NCCIT cell-derived embryoid bodies (EBs). Toxicol In Vitro. 2010 Sep;24(6):1696-704. doi: 10.1016/j.tiv.2010.05.017. Epub 2010 May 26.
• [44] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [45] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [46] Methamphetamine alters the normal progression by inducing cell cycle arrest in astrocytes. PLoS One. 2014 Oct 7;9(10):e109603.
• [47] Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
• [48] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [49] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [50] In silico, in vitro and in vivo studies: Dibutyl phthalate promotes prostate cancer cell proliferation by activating Forkhead Box M1 and remission after Natura- pretreatment. Toxicology. 2023 Apr;488:153465. doi: 10.1016/j.tox.2023.153465. Epub 2023 Feb 23.
• [51] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [52] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [53] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [54] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [55] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [56] Linking site-specific loss of histone acetylation to repression of gene expression by the mycotoxin ochratoxin A. Arch Toxicol. 2018 Feb;92(2):995-1014.