Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGUN89S)

DOT Name Multidrug resistance-associated protein 1 (ABCC1)
Synonyms EC 7.6.2.2; ATP-binding cassette sub-family C member 1; Glutathione-S-conjugate-translocating ATPase ABCC1; EC 7.6.2.3; Leukotriene C(4) transporter; LTC4 transporter
Gene Name ABCC1
Related Disease
Hearing loss, autosomal dominant 77 ( )
Autosomal dominant nonsyndromic hearing loss ( )
UniProt ID
MRP1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2CBZ; 4C3Z
EC Number
7.6.2.2; 7.6.2.3
Pfam ID
PF00664 ; PF00005
Sequence
MALRGFCSADGSDPLWDWNVTWNTSNPDFTKCFQNTVLVWVPCFYLWACFPFYFLYLSRH
DRGYIQMTPLNKTKTALGFLLWIVCWADLFYSFWERSRGIFLAPVFLVSPTLLGITMLLA
TFLIQLERRKGVQSSGIMLTFWLVALVCALAILRSKIMTALKEDAQVDLFRDITFYVYFS
LLLIQLVLSCFSDRSPLFSETIHDPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSD
LWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVYSSKDPAQPKESSKVDANEEVEAL
IVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPD
WQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTV
GEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLMVPVN
AVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLK
KSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILP
MVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDPPT
LNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQND
SLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLAR
AVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIV
MSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGM
LVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKL
SVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYG
ALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKEL
DTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVASSRQL
KRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLA
VRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVA
VERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGG
EKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLF
SGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCL
ARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVL
DKGEIQEYGAPSDLLQQRGLFYSMAKDAGLV
Function
Mediates export of organic anions and drugs from the cytoplasm. Mediates ATP-dependent transport of glutathione and glutathione conjugates, leukotriene C4, estradiol-17-beta-o-glucuronide, methotrexate, antiviral drugs and other xenobiotics. Confers resistance to anticancer drugs by decreasing accumulation of drug in cells, and by mediating ATP- and GSH-dependent drug export. Hydrolyzes ATP with low efficiency. Catalyzes the export of sphingosine 1-phosphate from mast cells independently of their degranulation. Participates in inflammatory response by allowing export of leukotriene C4 from leukotriene C4-synthezing cells. Mediates ATP-dependent, GSH-independent cyclic GMP-AMP (cGAMP) export. Thus, by limiting intracellular cGAMP concentrations negatively regulates the cGAS-STING pathway.
Tissue Specificity Lung, testis and peripheral blood mononuclear cells.
KEGG Pathway
Antifolate resistance (hsa01523 )
ABC transporters (hsa02010 )
Sphingolipid sig.ling pathway (hsa04071 )
Vitamin digestion and absorption (hsa04977 )
MicroR.s in cancer (hsa05206 )
Reactome Pathway
Synthesis of Leukotrienes (LT) and Eoxins (EX) (R-HSA-2142691 )
ABC-family proteins mediated transport (R-HSA-382556 )
Cytoprotection by HMOX1 (R-HSA-9707564 )
Paracetamol ADME (R-HSA-9753281 )
Transport of RCbl within the body (R-HSA-9758890 )
NFE2L2 regulating MDR associated enzymes (R-HSA-9818032 )
Heme degradation (R-HSA-189483 )
BioCyc Pathway
MetaCyc:ENSG00000103222-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Hearing loss, autosomal dominant 77 DISE6HNY Moderate Autosomal dominant [1]
Autosomal dominant nonsyndromic hearing loss DISYC1G0 Supportive Autosomal dominant [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Regulation of Drug Effects of 13 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Multidrug resistance-associated protein 1 (ABCC1) increases the transport of Valproate. [69]
Melphalan DMOLNHF Approved Multidrug resistance-associated protein 1 (ABCC1) affects the export of Melphalan. [75]
Nelfinavir mesylate DMFX6G8 Approved Multidrug resistance-associated protein 1 (ABCC1) affects the transport of Nelfinavir mesylate. [81]
Oxidized glutathione DM9EQC0 Approved Multidrug resistance-associated protein 1 (ABCC1) increases the export of Oxidized glutathione. [83]
Vadimezan DMK7CYX Phase 2 Multidrug resistance-associated protein 1 (ABCC1) affects the export of Vadimezan. [86]
Bilirubin DMI0V4O Investigative Multidrug resistance-associated protein 1 (ABCC1) affects the transport of Bilirubin. [88]
15-deoxy-Delta(12, 14)-prostaglandin J(2) DM8VUX3 Investigative Multidrug resistance-associated protein 1 (ABCC1) increases the transport of 15-deoxy-Delta(12, 14)-prostaglandin J(2). [89]
Ginsenoside Re DM46FVD Investigative Multidrug resistance-associated protein 1 (ABCC1) increases the transport of Ginsenoside Re. [91]
G418 DMKTJBU Investigative Multidrug resistance-associated protein 1 (ABCC1) increases the transport of G418. [51]
(E)-10-nitrooctadec-9-enoic acid DMTF7JA Investigative Multidrug resistance-associated protein 1 (ABCC1) increases the export of (E)-10-nitrooctadec-9-enoic acid. [92]
LTC4 DM702WR Investigative Multidrug resistance-associated protein 1 (ABCC1) decreases the transport of LTC4. [65]
[3H]estradiol-17beta-glucuronide DM3KJ45 Investigative Multidrug resistance-associated protein 1 (ABCC1) increases the transport of [3H]estradiol-17beta-glucuronide. [65]
6-Carboxyfluorescein DMWTMDH Investigative Multidrug resistance-associated protein 1 (ABCC1) increases the export of 6-Carboxyfluorescein. [93]
------------------------------------------------------------------------------------
⏷ Show the Full List of 13 Drug(s)
This DOT Affected the Drug Response of 25 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Cisplatin DMRHGI9 Approved Multidrug resistance-associated protein 1 (ABCC1) decreases the response to substance of Cisplatin. [70]
Arsenic trioxide DM61TA4 Approved Multidrug resistance-associated protein 1 (ABCC1) increases the response to substance of Arsenic trioxide. [71]
Cytarabine DMZD5QR Approved Multidrug resistance-associated protein 1 (ABCC1) affects the response to substance of Cytarabine. [4]
Etoposide DMNH3PG Approved Multidrug resistance-associated protein 1 (ABCC1) decreases the response to substance of Etoposide. [72]
Paclitaxel DMLB81S Approved Multidrug resistance-associated protein 1 (ABCC1) decreases the response to substance of Paclitaxel. [73]
Mitomycin DMH0ZJE Approved Multidrug resistance-associated protein 1 (ABCC1) decreases the response to substance of Mitomycin. [74]
Cyclophosphamide DM4O2Z7 Approved Multidrug resistance-associated protein 1 (ABCC1) decreases the response to substance of Cyclophosphamide. [74]
Vinblastine DM5TVS3 Approved Multidrug resistance-associated protein 1 (ABCC1) decreases the response to substance of Vinblastine. [76]
Daunorubicin DMQUSBT Approved Multidrug resistance-associated protein 1 (ABCC1) decreases the response to substance of Daunorubicin. [77]
Colchicine DM2POTE Approved Multidrug resistance-associated protein 1 (ABCC1) decreases the response to substance of Colchicine. [78]
Sorafenib DMS8IFC Approved Multidrug resistance-associated protein 1 (ABCC1) affects the response to substance of Sorafenib. [79]
Dactinomycin DM2YGNW Approved Multidrug resistance-associated protein 1 (ABCC1) decreases the response to substance of Dactinomycin. [78]
Romidepsin DMT5GNL Approved Multidrug resistance-associated protein 1 (ABCC1) decreases the response to substance of Romidepsin. [80]
Chlorambucil DMRKE63 Approved Multidrug resistance-associated protein 1 (ABCC1) decreases the response to substance of Chlorambucil. [72]
Ethacrynic acid DM60QMR Approved Multidrug resistance-associated protein 1 (ABCC1) decreases the response to substance of Ethacrynic acid. [72]
Loratadine DMF3AN7 Approved Multidrug resistance-associated protein 1 (ABCC1) decreases the response to substance of Loratadine. [82]
Thiotepa DMIZKOP Approved Multidrug resistance-associated protein 1 (ABCC1) decreases the response to substance of Thiotepa. [74]
Zileuton DMVRIC2 Approved Multidrug resistance-associated protein 1 (ABCC1) affects the response to substance of Zileuton. [84]
Nitazoxanide DMOWLVG Approved Multidrug resistance-associated protein 1 (ABCC1) affects the response to substance of Nitazoxanide. [85]
Fosinopril DM9NJ52 Approved Multidrug resistance-associated protein 1 (ABCC1) decreases the response to substance of Fosinopril. [82]
Resveratrol DM3RWXL Phase 3 Multidrug resistance-associated protein 1 (ABCC1) decreases the response to substance of Resveratrol. [76]
Camptothecin DM6CHNJ Phase 3 Multidrug resistance-associated protein 1 (ABCC1) decreases the response to substance of Camptothecin. [74]
Homocamptothecin DMBQDA3 Preclinical Multidrug resistance-associated protein 1 (ABCC1) affects the response to substance of Homocamptothecin. [87]
Apicidin DM83WVF Investigative Multidrug resistance-associated protein 1 (ABCC1) decreases the response to substance of Apicidin. [80]
Hydroxydimethylarsine Oxide DMPS2B1 Investigative Multidrug resistance-associated protein 1 (ABCC1) decreases the response to substance of Hydroxydimethylarsine Oxide. [90]
------------------------------------------------------------------------------------
⏷ Show the Full List of 25 Drug(s)
This DOT Affected the Biotransformations of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Adenosine triphosphate DM79F6G Approved Multidrug resistance-associated protein 1 (ABCC1) increases the hydrolysis of Adenosine triphosphate. [76]
------------------------------------------------------------------------------------
83 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Multidrug resistance-associated protein 1 (ABCC1). [2]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Multidrug resistance-associated protein 1 (ABCC1). [3]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Multidrug resistance-associated protein 1 (ABCC1). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Multidrug resistance-associated protein 1 (ABCC1). [5]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Multidrug resistance-associated protein 1 (ABCC1). [6]
Ivermectin DMDBX5F Approved Ivermectin decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [7]
Arsenic DMTL2Y1 Approved Arsenic increases the expression of Multidrug resistance-associated protein 1 (ABCC1). [8]
Quercetin DM3NC4M Approved Quercetin increases the expression of Multidrug resistance-associated protein 1 (ABCC1). [9]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Multidrug resistance-associated protein 1 (ABCC1). [10]
Testosterone DM7HUNW Approved Testosterone increases the expression of Multidrug resistance-associated protein 1 (ABCC1). [10]
Triclosan DMZUR4N Approved Triclosan increases the expression of Multidrug resistance-associated protein 1 (ABCC1). [11]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Multidrug resistance-associated protein 1 (ABCC1). [12]
Decitabine DMQL8XJ Approved Decitabine increases the expression of Multidrug resistance-associated protein 1 (ABCC1). [13]
Marinol DM70IK5 Approved Marinol decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [14]
Folic acid DMEMBJC Approved Folic acid affects the activity of Multidrug resistance-associated protein 1 (ABCC1). [15]
Cannabidiol DM0659E Approved Cannabidiol decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [14]
Bortezomib DMNO38U Approved Bortezomib decreases the expression of Multidrug resistance-associated protein 1 (ABCC1). [16]
Aspirin DM672AH Approved Aspirin increases the expression of Multidrug resistance-associated protein 1 (ABCC1). [17]
Irinotecan DMP6SC2 Approved Irinotecan decreases the expression of Multidrug resistance-associated protein 1 (ABCC1). [18]
Indomethacin DMSC4A7 Approved Indomethacin decreases the expression of Multidrug resistance-associated protein 1 (ABCC1). [19]
Rifampicin DM5DSFZ Approved Rifampicin increases the expression of Multidrug resistance-associated protein 1 (ABCC1). [20]
Zidovudine DM4KI7O Approved Zidovudine increases the expression of Multidrug resistance-associated protein 1 (ABCC1). [21]
Sulindac DM2QHZU Approved Sulindac increases the expression of Multidrug resistance-associated protein 1 (ABCC1). [22]
Haloperidol DM96SE0 Approved Haloperidol decreases the expression of Multidrug resistance-associated protein 1 (ABCC1). [23]
Docetaxel DMDI269 Approved Docetaxel increases the expression of Multidrug resistance-associated protein 1 (ABCC1). [24]
Ardeparin DMYRX8B Approved Ardeparin affects the activity of Multidrug resistance-associated protein 1 (ABCC1). [25]
Mebendazole DMO14SG Approved Mebendazole decreases the expression of Multidrug resistance-associated protein 1 (ABCC1). [26]
Epirubicin DMPDW6T Approved Epirubicin increases the expression of Multidrug resistance-associated protein 1 (ABCC1). [27]
Methoxsalen DME8FZ9 Approved Methoxsalen increases the expression of Multidrug resistance-associated protein 1 (ABCC1). [28]
Benzbromarone DMC3YUA Approved Benzbromarone affects the activity of Multidrug resistance-associated protein 1 (ABCC1). [29]
Glibenclamide DM8JXPZ Approved Glibenclamide decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [30]
Probenecid DMMFWOJ Approved Probenecid decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [31]
Dabrafenib DMX6OE3 Approved Dabrafenib increases the expression of Multidrug resistance-associated protein 1 (ABCC1). [32]
Sulfinpyrazone DMEV954 Approved Sulfinpyrazone decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [33]
Dihydrotestosterone DM3S8XC Phase 4 Dihydrotestosterone decreases the expression of Multidrug resistance-associated protein 1 (ABCC1). [34]
Isoflavone DM7U58J Phase 4 Isoflavone decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [35]
Beclomethasone dipropionate DM5NW1E Phase 4 Beclomethasone dipropionate increases the expression of Multidrug resistance-associated protein 1 (ABCC1). [36]
Epigallocatechin gallate DMCGWBJ Phase 3 Epigallocatechin gallate decreases the expression of Multidrug resistance-associated protein 1 (ABCC1). [37]
Curcumin DMQPH29 Phase 3 Curcumin decreases the expression of Multidrug resistance-associated protein 1 (ABCC1). [38]
Chloroquine DMSI5CB Phase 3 Trial Chloroquine decreases the expression of Multidrug resistance-associated protein 1 (ABCC1). [39]
5-methoxypsoralen DME2A8X Phase 3 5-methoxypsoralen increases the expression of Multidrug resistance-associated protein 1 (ABCC1). [28]
MLN8237 DMO8PT9 Phase 3 MLN8237 decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [40]
CMS-024-02 DMC4X7L Phase 3 CMS-024-02 decreases the expression of Multidrug resistance-associated protein 1 (ABCC1). [41]
Genistein DM0JETC Phase 2/3 Genistein decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [35]
Verapamil DMA7PEW Phase 2/3 Trial Verapamil decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [33]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate decreases the expression of Multidrug resistance-associated protein 1 (ABCC1). [42]
Disulfiram DMCL2OK Phase 2 Trial Disulfiram decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [43]
BAICALEIN DM4C7E6 Phase 2 BAICALEIN decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [44]
Impoyz DMB1N6P Phase 2 Impoyz decreases the expression of Multidrug resistance-associated protein 1 (ABCC1). [45]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of Multidrug resistance-associated protein 1 (ABCC1). [47]
PMID26394986-Compound-22 DM43Z1G Patented PMID26394986-Compound-22 decreases the expression of Multidrug resistance-associated protein 1 (ABCC1). [49]
Flavonoid derivative 1 DMCQP0B Patented Flavonoid derivative 1 decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [44]
Taxifolin DMQJSF9 Preclinical Taxifolin decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [50]
Puromycin DMDKLB5 Preclinical Puromycin increases the expression of Multidrug resistance-associated protein 1 (ABCC1). [51]
Nimesulide DMR1NMD Terminated Nimesulide increases the expression of Multidrug resistance-associated protein 1 (ABCC1). [52]
NS398 DMINUWH Terminated NS398 increases the expression of Multidrug resistance-associated protein 1 (ABCC1). [52]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Multidrug resistance-associated protein 1 (ABCC1). [53]
Paraquat DMR8O3X Investigative Paraquat decreases the expression of Multidrug resistance-associated protein 1 (ABCC1). [54]
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE DMNQL17 Investigative 2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE increases the expression of Multidrug resistance-associated protein 1 (ABCC1). [56]
U0126 DM31OGF Investigative U0126 decreases the expression of Multidrug resistance-associated protein 1 (ABCC1). [57]
Rutin DMEHRAJ Investigative Rutin decreases the expression of Multidrug resistance-associated protein 1 (ABCC1). [58]
Kaempferol DMHEMUB Investigative Kaempferol decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [44]
Apigenin DMI3491 Investigative Apigenin decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [44]
2-tert-butylbenzene-1,4-diol DMNXI1E Investigative 2-tert-butylbenzene-1,4-diol increases the expression of Multidrug resistance-associated protein 1 (ABCC1). [9]
biochanin A DM0HPWY Investigative biochanin A decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [59]
Myricetin DMTV4L0 Investigative Myricetin decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [44]
27-hydroxycholesterol DM2L6OZ Investigative 27-hydroxycholesterol increases the expression of Multidrug resistance-associated protein 1 (ABCC1). [60]
Morin DM2OGZ5 Investigative Morin decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [44]
Piceatannol DMYOP45 Investigative Piceatannol decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [61]
Galangin DM5TQ2O Investigative Galangin decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [44]
Flavone DMEQH6J Investigative Flavone decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [50]
DEMETHOXYCURCUMIN DMO5UGV Investigative DEMETHOXYCURCUMIN decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [62]
Caffeic acid phenethyl ester DMRJKIV Investigative Caffeic acid phenethyl ester decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [62]
Formononetin DM7WFZ8 Investigative Formononetin decreases the expression of Multidrug resistance-associated protein 1 (ABCC1). [63]
ISORHAMNETIN DMQ4Z6E Investigative ISORHAMNETIN decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [44]
PI-103 DMEK4TJ Investigative PI-103 decreases the expression of Multidrug resistance-associated protein 1 (ABCC1). [66]
DIOSMETIN DM4KXIM Investigative DIOSMETIN decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [44]
ERIODICTYOL DMD3BEQ Investigative ERIODICTYOL decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [44]
7,3',4'-trihydroxyisoflavone DM5JV8G Investigative 7,3',4'-trihydroxyisoflavone decreases the expression of Multidrug resistance-associated protein 1 (ABCC1). [67]
18beta-Glycyrrhetic acid DMFMRN8 Investigative 18beta-Glycyrrhetic acid increases the activity of Multidrug resistance-associated protein 1 (ABCC1). [68]
ROBINETIN DMASOWP Investigative ROBINETIN decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [44]
CHRYSOERIOL DM96ECL Investigative CHRYSOERIOL decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [44]
cannabinol DMM6A7P Investigative cannabinol decreases the activity of Multidrug resistance-associated protein 1 (ABCC1). [14]
------------------------------------------------------------------------------------
⏷ Show the Full List of 83 Drug(s)
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Multidrug resistance-associated protein 1 (ABCC1). [46]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 increases the phosphorylation of Multidrug resistance-associated protein 1 (ABCC1). [48]
Coumarin DM0N8ZM Investigative Coumarin decreases the phosphorylation of Multidrug resistance-associated protein 1 (ABCC1). [48]
------------------------------------------------------------------------------------
3 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
4-hydroxy-2-nonenal DM2LJFZ Investigative 4-hydroxy-2-nonenal affects the binding of Multidrug resistance-associated protein 1 (ABCC1). [55]
Buthionine sulfoximine DMJ46CB Investigative Buthionine sulfoximine affects the localization of Multidrug resistance-associated protein 1 (ABCC1). [64]
adenosine diphosphate DMFUHKP Investigative adenosine diphosphate affects the binding of Multidrug resistance-associated protein 1 (ABCC1). [65]
------------------------------------------------------------------------------------

References

1 Extrusion pump ABCC1 was first linked with nonsyndromic hearing loss in humans by stepwise genetic analysis. Genet Med. 2019 Dec;21(12):2744-2754. doi: 10.1038/s41436-019-0594-y. Epub 2019 Jul 5.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Induction of hepatobiliary efflux transporters in acetaminophen-induced acute liver failure cases. Drug Metab Dispos. 2007 Oct;35(10):1963-9. doi: 10.1124/dmd.107.016170. Epub 2007 Jul 12.
4 Upregulation of multi drug resistance genes in doxorubicin resistant human acute myelogeneous leukemia cells and reversal of the resistance. Hematology. 2007 Dec;12(6):511-7. doi: 10.1080/10245330701562535.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
7 Characterization of multidrug transporter-mediated efflux of avermectins in human and mouse neuroblastoma cell lines. Toxicol Lett. 2015 Jun 15;235(3):189-98. doi: 10.1016/j.toxlet.2015.04.005. Epub 2015 Apr 9.
8 Interplay between cellular methyl metabolism and adaptive efflux during oncogenic transformation from chronic arsenic exposure in human cells. J Biol Chem. 2008 Jul 11;283(28):19342-50.
9 Influence of redox-active compounds and PXR-activators on human MRP1 and MRP2 gene expression. Toxicology. 2002 Feb 28;171(2-3):137-46.
10 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
11 Triclosan treatment decreased the antitumor effect of sorafenib on hepatocellular carcinoma cells. Onco Targets Ther. 2018 May 18;11:2945-2954.
12 Methotrexate normalizes up-regulated folate pathway genes in rheumatoid arthritis. Arthritis Rheum. 2013 Nov;65(11):2791-802.
13 Methylation-dependent silencing of the reduced folate carrier gene in inherently methotrexate-resistant human breast cancer cells. J Biol Chem. 2001 Oct 26;276(43):39990-40000.
14 Interaction of plant cannabinoids with the multidrug transporter ABCC1 (MRP1). Eur J Pharmacol. 2008 Sep 4;591(1-3):128-31.
15 Folate concentration dependent transport activity of the Multidrug Resistance Protein 1 (ABCC1). Biochem Pharmacol. 2004 Apr 15;67(8):1541-8.
16 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
17 Prolonged use of aspirin alters human and rat intestinal cells and thereby limits the absorption of clopidogrel. Clin Pharmacol Ther. 2011 Oct;90(4):612-9. doi: 10.1038/clpt.2011.163. Epub 2011 Sep 7.
18 Clinical determinants of response to irinotecan-based therapy derived from cell line models. Clin Cancer Res. 2008 Oct 15;14(20):6647-55.
19 Alleviation of the drug-resistant phenotype in idarubicin and cytosine arabinoside double-resistant acute myeloid leukemia cells by indomethacin. Int J Oncol. 2008 Apr;32(4):931-6.
20 Venlafaxine induces P-glycoprotein in human Caco-2 cells. Hum Psychopharmacol. 2007 Jan;22(1):49-53. doi: 10.1002/hup.820.
21 Differential gene expression in human hepatocyte cell lines exposed to the antiretroviral agent zidovudine. Arch Toxicol. 2014 Mar;88(3):609-23. doi: 10.1007/s00204-013-1169-3. Epub 2013 Nov 30.
22 Induction of multidrug resistance proteins MRP1 and MRP3 and gamma-glutamylcysteine synthetase gene expression by nonsteroidal anti-inflammatory drugs in human colon cancer cells. Biochem Biophys Res Commun. 2002 Feb 8;290(5):1427-33. doi: 10.1006/bbrc.2002.6367.
23 Reversal effect of haloperidol on doxorubicin resistance and chloride channel inhibition in erythroleukemic cell K562/Dox. Zhonghua Zhong Liu Za Zhi. 2005 Feb;27(2):81-5.
24 Enhanced in vitro invasiveness and drug resistance with altered gene expression patterns in a human lung carcinoma cell line after pulse selection with anticancer drugs. Int J Cancer. 2004 Sep 10;111(4):484-93. doi: 10.1002/ijc.20230.
25 Modulatory effects of heparin on cellular accumulation and cytotoxicity of doxorubicin in MRP1-overexpressing HL60/doxo cells. Anticancer Res. 2007 Jan-Feb;27(1A):351-5.
26 Mebendazole, an antiparasitic drug, inhibits drug transporters expression in preclinical model of gastric peritoneal carcinomatosis. Toxicol In Vitro. 2017 Sep;43:87-91. doi: 10.1016/j.tiv.2017.06.007. Epub 2017 Jun 9.
27 Co-encapsulation of chrysophsin-1 and epirubicin in PEGylated liposomes circumvents multidrug resistance in HeLa cells. Chem Biol Interact. 2015 Dec 5;242:13-23. doi: 10.1016/j.cbi.2015.08.023. Epub 2015 Sep 1.
28 ABC-transporter blockage mediated by xanthotoxin and bergapten is the major pathway for chemosensitization of multidrug-resistant cancer cells. Toxicol Appl Pharmacol. 2017 Dec 15;337:22-29. doi: 10.1016/j.taap.2017.10.018. Epub 2017 Oct 25.
29 Possible role of the multidrug resistance-associated protein (MRP) in chemoresistance of human melanoma cells. Int J Cancer. 1997 Mar 28;71(1):108-15. doi: 10.1002/(sici)1097-0215(19970328)71:1<108::aid-ijc18>3.0.co;2-e.
30 Role of two adjacent cytoplasmic tyrosine residues in MRP1 (ABCC1) transport activity and sensitivity to sulfonylureas. Biochem Pharmacol. 2005 Feb 1;69(3):451-61. doi: 10.1016/j.bcp.2004.10.014. Epub 2004 Dec 16.
31 Mercury induces multidrug resistance-associated protein gene through p38 mitogen-activated protein kinase. Toxicol Lett. 2005 Jan 15;155(1):143-50. doi: 10.1016/j.toxlet.2004.09.007.
32 Dabrafenib inhibits ABCG2 and cytochrome P450 isoenzymes; potential implications for combination anticancer therapy. Toxicol Appl Pharmacol. 2022 Jan 1;434:115797. doi: 10.1016/j.taap.2021.115797. Epub 2021 Nov 13.
33 Glutathione S-transferase M1 and multidrug resistance protein 1 act in synergy to protect melanoma cells from vincristine effects. Mol Pharmacol. 2004 Apr;65(4):897-905. doi: 10.1124/mol.65.4.897.
34 Androgen induces expression of the multidrug resistance protein gene MRP4 in prostate cancer cells. Prostate Cancer Prostatic Dis. 2007;10(1):39-45.
35 Modulation of MRP1 protein transport by plant, and synthetically modified flavonoids. Life Sci. 2005 Aug 26;77(15):1879-91.
36 Induction of drug-metabolizing enzymes and transporters in human bronchial epithelial cells by beclomethasone dipropionate. IUBMB Life. 2004 Jun;56(6):355-9.
37 Low dose epigallocatechin-3-gallate revives doxorubicin responsiveness by a redox-sensitive pathway in A549 lung adenocarcinoma cells. J Biochem Mol Toxicol. 2022 Apr;36(4):e22999. doi: 10.1002/jbt.22999. Epub 2022 Feb 26.
38 Novel carbocyclic curcumin analog CUR3d modulates genes involved in multiple apoptosis pathways in human hepatocellular carcinoma cells. Chem Biol Interact. 2015 Dec 5;242:107-22.
39 Autophagy inhibition upregulates CD4(+) tumor infiltrating lymphocyte expression via miR-155 regulation and TRAIL activation. Mol Oncol. 2016 Dec;10(10):1516-1531. doi: 10.1016/j.molonc.2016.08.005. Epub 2016 Sep 16.
40 Alisertib shows negligible potential for perpetrating pharmacokinetic drug-drug interactions on ABCB1, ABCG2 and cytochromes P450, but acts as dual-activity resistance modulator through the inhibition of ABCC1 transporter. Toxicol Appl Pharmacol. 2022 Jan 1;434:115823. doi: 10.1016/j.taap.2021.115823. Epub 2021 Dec 9.
41 Reversal effect of tyroservatide (YSV) tripeptide on multi-drug resistance in resistant human hepatocellular carcinoma cell line BEL-7402/5-FU. Cancer Lett. 2008 Sep 28;269(1):101-10. doi: 10.1016/j.canlet.2008.04.033. Epub 2008 Jun 5.
42 Differentiation and drug resistance relationships in leukemia cells. J Cell Biochem. 2005 Jan 1;94(1):98-108. doi: 10.1002/jcb.20278.
43 The molecular basis of the action of disulfiram as a modulator of the multidrug resistance-linked ATP binding cassette transporters MDR1 (ABCB1) and MRP1 (ABCC1). Mol Pharmacol. 2004 Mar;65(3):675-84.
44 Quantitative structure activity relationship studies on the flavonoid mediated inhibition of multidrug resistance proteins 1 and 2. Biochem Pharmacol. 2005 Feb 15;69(4):699-708. doi: 10.1016/j.bcp.2004.11.002. Epub 2004 Dec 23.
45 Regulation of cutaneous drug-metabolizing enzymes and cytoprotective gene expression by topical drugs in human skin in vivo. Br J Dermatol. 2006 Aug;155(2):275-81.
46 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
47 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
48 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
49 Differential effects of selective cyclooxygenase-2 inhibitors in inhibiting proliferation and induction of apoptosis in oral squamous cell carcinoma. Oncol Rep. 2008 Feb;19(2):425-33.
50 Structural requirements for the flavonoid-mediated modulation of glutathione S-transferase P1-1 and GS-X pump activity in MCF7 breast cancer cells. Biochem Pharmacol. 2004 Apr 15;67(8):1607-17.
51 ATP-binding cassette transporters as pitfalls in selection of transgenic cells. Anal Biochem. 2010 Apr 15;399(2):246-50. doi: 10.1016/j.ab.2009.12.014. Epub 2009 Dec 14.
52 COX-2 inhibitors block chemotherapeutic agent-induced apoptosis prior to commitment in hematopoietic cancer cells. Biochem Pharmacol. 2011 Nov 15;82(10):1277-90. doi: 10.1016/j.bcp.2011.06.028. Epub 2011 Jun 24.
53 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
54 Cycloartenyl Ferulate Inhibits Paraquat-Induced Apoptosis in HK-2 Cells With the Involvement of ABCC1. J Cell Biochem. 2016 Apr;117(4):872-80. doi: 10.1002/jcb.25370. Epub 2015 Sep 29.
55 Oxidatively modified GST and MRP1 in Alzheimer's disease brain: implications for accumulation of reactive lipid peroxidation products. Neurochem Res. 2004 Dec;29(12):2215-20. doi: 10.1007/s11064-004-7028-0.
56 ABCG2/BCRP decreases the transfer of a food-born chemical carcinogen, 2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine (PhIP) in perfused term human placenta. Toxicol Appl Pharmacol. 2008 Oct 15;232(2):210-7. doi: 10.1016/j.taap.2008.07.006. Epub 2008 Jul 18.
57 Involvement of extracellular signal-regulated kinase/mitogen-activated protein kinase pathway in multidrug resistance induced by HBx in hepatoma cell line. World J Gastroenterol. 2004 Dec 1;10(23):3522-7. doi: 10.3748/wjg.v10.i23.3522.
58 Epicatechin and a cocoa polyphenolic extract modulate gene expression in human Caco-2 cells. J Nutr. 2004 Oct;134(10):2509-16.
59 Metabolic O-demethylation does not alter the influence of isoflavones on the biophysical properties of membranes and MRP1-like protein transport activity. Arch Biochem Biophys. 2005 Jan 15;433(2):428-34. doi: 10.1016/j.abb.2004.10.004.
60 27-Hydroxycholesterol is a specific factor in the neoplastic microenvironment of HCC that causes MDR via GRP75 regulation of the redox balance and metabolic reprogramming. Cell Biol Toxicol. 2022 Apr;38(2):311-324. doi: 10.1007/s10565-021-09607-y. Epub 2021 Apr 20.
61 Resveratrol oligomers are potent MRP1 transport inhibitors. Anticancer Res. 2006 May-Jun;26(3A):2081-4.
62 Inhibition of multidrug resistance proteins MRP1 and MRP2 by a series of alpha,beta-unsaturated carbonyl compounds. Biochem Pharmacol. 2005 Jun 15;69(12):1879-90. doi: 10.1016/j.bcp.2005.04.001.
63 Formononetin potentiates epirubicin-induced apoptosis via ROS production in HeLa cells in vitro. Chem Biol Interact. 2013 Oct 5;205(3):188-97. doi: 10.1016/j.cbi.2013.07.003. Epub 2013 Jul 16.
64 Mistargeted MRPdeltaF728 mutant is rescued by intracellular GSH. FEBS Lett. 2004 Dec 3;578(1-2):145-51. doi: 10.1016/j.febslet.2004.10.089.
65 Role of proline 1150 in functional interactions between the membrane spanning domains and nucleotide binding domains of the MRP1 (ABCC1) transporter. Biochem Pharmacol. 2008 Apr 15;75(8):1659-69. doi: 10.1016/j.bcp.2008.01.009. Epub 2008 Feb 5.
66 PI3K inhibition enhances doxorubicin-induced apoptosis in sarcoma cells. PLoS One. 2012;7(12):e52898. doi: 10.1371/journal.pone.0052898. Epub 2012 Dec 31.
67 7,3',4'-Trihydroxyisoflavone modulates multidrug resistance transporters and induces apoptosis via production of reactive oxygen species. Toxicology. 2012 Dec 16;302(2-3):221-32. doi: 10.1016/j.tox.2012.08.003. Epub 2012 Aug 15.
68 Inhibition of P-glycoprotein and multidrug resistance protein 1 by dietary phytochemicals. Cancer Chemother Pharmacol. 2008 Oct;62(5):867-73.
69 Valproic acid uptake by bovine brain microvessel endothelial cells: role of active efflux transport. Epilepsy Res. 2004 Jan;58(1):53-66. doi: 10.1016/j.eplepsyres.2003.12.008.
70 Human osteosarcoma xenografts and their sensitivity to chemotherapy. Pathol Oncol Res. 2004;10(3):133-41. doi: 10.1007/BF03033741. Epub 2004 Sep 25.
71 Functional Profiling Identifies Determinants of Arsenic Trioxide Cellular Toxicity. Toxicol Sci. 2019 May 1;169(1):108-121. doi: 10.1093/toxsci/kfz024.
72 The influence of coordinate overexpression of glutathione phase II detoxification gene products on drug resistance. J Pharmacol Exp Ther. 2000 Aug;294(2):480-7.
73 Phosphatidylinositol 3'-kinase activation leads to multidrug resistance protein-1 expression and subsequent chemoresistance in advanced prostate cancer cells. Cancer Res. 2004 Nov 15;64(22):8397-404. doi: 10.1158/0008-5472.CAN-04-1612.
74 [Establishment of MRP-overexpression subline of bladder carcinoma and its MDR phenotype]. Zhonghua Zhong Liu Za Zhi. 2000 Jul;22(4):273-5.
75 Role of multidrug resistance protein 1 (MRP1) and glutathione S-transferase A1-1 in alkylating agent resistanceKinetics of glutathione conjugate formation and efflux govern differential cellular sensitivity to chlorambucil versus melphalan toxicity. J Biol Chem. 2001 Mar 16;276(11):7952-6.
76 Modulatory effects of plant phenols on human multidrug-resistance proteins 1, 4 and 5 (ABCC1, 4 and 5). FEBS J. 2005 Sep;272(18):4725-40.
77 Cloning and functional characterization of the multidrug resistance-associated protein (MRP1/ABCC1) from the cynomolgus monkey. Mol Cancer Ther. 2003 Mar;2(3):307-16.
78 Functional analysis of MRP1 cloned from bovine. FEBS Lett. 2002 Jun 19;521(1-3):211-3. doi: 10.1016/s0014-5793(02)02816-8.
79 The Enhanced metastatic potential of hepatocellular carcinoma (HCC) cells with sorafenib resistance. PLoS One. 2013 Nov 11;8(11):e78675. doi: 10.1371/journal.pone.0078675. eCollection 2013.
80 Involvement of P-glycoprotein and MRP1 in resistance to cyclic tetrapeptide subfamily of histone deacetylase inhibitors in the drug-resistant osteosarcoma and Ewing's sarcoma cells. Int J Cancer. 2006 Jan 1;118(1):90-7. doi: 10.1002/ijc.21297.
81 Influence of ABCB1, ABCC1, ABCC2, and ABCG2 haplotypes on the cellular exposure of nelfinavir in vivo. Pharmacogenet Genomics. 2005 Sep;15(9):599-608. doi: 10.1097/01.fpc.0000172241.42546.d3.
82 Mrp2 is involved in the efflux and disposition of fosinopril. J Appl Toxicol. 2013 Jun;33(6):458-65. doi: 10.1002/jat.1767. Epub 2011 Nov 17.
83 Role of the multidrug resistance protein-1 in hypertension and vascular dysfunction caused by angiotensin II. Arterioscler Thromb Vasc Biol. 2007 Apr;27(4):762-8. doi: 10.1161/01.ATV.0000259298.11129.a2. Epub 2007 Feb 1.
84 5-lipoxygenase pharmacogenetics in asthma: overlap with Cys-leukotriene receptor antagonist loci. Pharmacogenet Genomics. 2009 Mar;19(3):244-7. doi: 10.1097/FPC.0b013e328326e0b1.
85 Population-based in vitro hazard and concentration-response assessment of chemicals: the 1000 genomes high-throughput screening study. Environ Health Perspect. 2015 May;123(5):458-66. doi: 10.1289/ehp.1408775. Epub 2015 Jan 13.
86 Transport of the investigational anti-cancer drug 5,6-dimethylxanthenone-4-acetic acid and its acyl glucuronide by human intestinal Caco-2 cells. Eur J Pharm Sci. 2005 Apr;24(5):513-24. doi: 10.1016/j.ejps.2005.01.006.
87 Homocamptothecin-daunorubicin association overcomes multidrug-resistance in breast cancer MCF7 cells. Breast Cancer Res Treat. 2002 May;73(2):113-25. doi: 10.1023/a:1015244604336.
88 The human multidrug-resistance-associated protein MRP1 mediates ATP-dependent transport of unconjugated bilirubin. Biochem J. 2004 Oct 15;383(Pt 2):335-41. doi: 10.1042/BJ20040599.
89 Multidrug resistance-associated protein 1 mediates 15-deoxy-(12,14)-prostaglandin J2-induced expression of glutamate cysteine ligase expression via Nrf2 signaling in human breast cancer cells. Chem Res Toxicol. 2011 Aug 15;24(8):1231-41. doi: 10.1021/tx200090n. Epub 2011 Jul 25.
90 Multidrug Resistance Protein 1 (MRP1/ABCC1)-Mediated Cellular Protection and Transport of Methylated Arsenic Metabolites Differs between Human Cell Lines. Drug Metab Dispos. 2018 Aug;46(8):1096-1105. doi: 10.1124/dmd.117.079640. Epub 2018 May 11.
91 Molecular mechanisms governing different pharmacokinetics of ginsenosides and potential for ginsenoside-perpetrated herb-drug interactions on OATP1B3. Br J Pharmacol. 2015 Feb;172(4):1059-73. doi: 10.1111/bph.12971. Epub 2015 Jan 20.
92 Nitro-fatty acid inhibition of triple-negative breast cancer cell viability, migration, invasion, and tumor growth. J Biol Chem. 2018 Jan 26;293(4):1120-1137. doi: 10.1074/jbc.M117.814368. Epub 2017 Nov 20.
93 Indomethacin induces apoptosis via a MRP1-dependent mechanism in doxorubicin-resistant small-cell lung cancer cells overexpressing MRP1. Br J Cancer. 2007 Oct 22;97(8):1077-83.