Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTH9MXD6)

• DOT Name: ETS domain-containing protein Elk-1 (ELK1)
• Gene Name: ELK1
• Related Disease:
  Clear cell renal carcinoma
  Colorectal carcinoma
  Neuroblastoma
  Acute myelogenous leukaemia
  Advanced cancer
  Alzheimer disease
  Bladder cancer
  Bone osteosarcoma
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Cervical cancer
  Cervical carcinoma
  Colon cancer
  Colon carcinoma
  Depression
  Epithelial ovarian cancer
  Esophageal squamous cell carcinoma
  Glioma
  Hepatitis B virus infection
  Hepatocellular carcinoma
  Huntington disease
  Lung adenocarcinoma
  Lung cancer
  Lung carcinoma
  Osteosarcoma
  Ovarian cancer
  Ovarian neoplasm
  Prostate neoplasm
  Renal cell carcinoma
  Systemic lupus erythematosus
  Tarsal-carpal coalition syndrome
  Urinary bladder cancer
  Urinary bladder neoplasm
  Adult glioblastoma
  Arteriosclerosis
  Atherosclerosis
  Carcinoma of liver and intrahepatic biliary tract
  Liver cancer
  Osteoarthritis
  Pulmonary fibrosis
  Gastric cancer
  Non-small-cell lung cancer
  Stomach cancer
  Glioblastoma multiforme
  Prostate cancer
  Prostate carcinoma
  Triple negative breast cancer
• UniProt ID: ELK1_HUMAN
• PDB ID: 1DUX; 5VVT
• Pfam ID: PF00178
• Sequence:
  MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL
  SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIH
  AAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVV
  LPSAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGL
  GRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGH
  AASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGSGSGLQAPGPALTPSLLPTH
  TLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVV
  LSPGPQKP
• Function: Transcription factor that binds to purine-rich DNA sequences. Forms a ternary complex with SRF and the ETS and SRF motifs of the serum response element (SRE) on the promoter region of immediate early genes such as FOS and IER2. Induces target gene transcription upon JNK-signaling pathway stimulation.
• Tissue Specificity: Lung and testis.
• KEGG Pathway:
  MAPK sig.ling pathway (hsa04010)
  ErbB sig.ling pathway (hsa04012)
  Ras sig.ling pathway (hsa04014)
  Focal adhesion (hsa04510)
  Insulin sig.ling pathway (hsa04910)
  GnRH sig.ling pathway (hsa04912)
  Oxytocin sig.ling pathway (hsa04921)
  Leishmaniasis (hsa05140)
  Hepatitis B (hsa05161)
  Human cytomegalovirus infection (hsa05163)
  Human T-cell leukemia virus 1 infection (hsa05166)
  Pathways in cancer (hsa05200)
  Proteoglycans in cancer (hsa05205)
  Endometrial cancer (hsa05213)
  Hepatocellular carcinoma (hsa05225)
• Reactome Pathway:
  NGF-stimulated transcription (R-HSA-9031628)
  HCMV Early Events (R-HSA-9609690)
  Estrogen-dependent nuclear events downstream of ESR-membrane signaling (R-HSA-9634638)
  ERK/MAPK targets (R-HSA-198753)

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Clear cell renal carcinoma	DISBXRFJ	Definitive	Altered Expression	[1]
Colorectal carcinoma	DIS5PYL0	Definitive	Biomarker	[2]
Neuroblastoma	DISVZBI4	Definitive	Biomarker	[3]
Acute myelogenous leukaemia	DISCSPTN	Strong	Altered Expression	[4]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[5]
Alzheimer disease	DISF8S70	Strong	Biomarker	[6]
Bladder cancer	DISUHNM0	Strong	Altered Expression	[7]
Bone osteosarcoma	DIST1004	Strong	Altered Expression	[8]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[9]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[9]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[10]
Cervical cancer	DISFSHPF	Strong	Altered Expression	[11]
Cervical carcinoma	DIST4S00	Strong	Altered Expression	[11]
Colon cancer	DISVC52G	Strong	Biomarker	[12]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[12]
Depression	DIS3XJ69	Strong	Biomarker	[13]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[14]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[15]
Glioma	DIS5RPEH	Strong	Altered Expression	[16]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[17]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[18]
Huntington disease	DISQPLA4	Strong	Biomarker	[19]
Lung adenocarcinoma	DISD51WR	Strong	Altered Expression	[20]
Lung cancer	DISCM4YA	Strong	Altered Expression	[18]
Lung carcinoma	DISTR26C	Strong	Posttranslational Modification	[21]
Osteosarcoma	DISLQ7E2	Strong	Altered Expression	[8]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[14]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[14]
Prostate neoplasm	DISHDKGQ	Strong	Altered Expression	[22]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[23]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[24]
Tarsal-carpal coalition syndrome	DISY90L2	Strong	Altered Expression	[25]
Urinary bladder cancer	DISDV4T7	Strong	Altered Expression	[7]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[7]
Adult glioblastoma	DISVP4LU	moderate	Altered Expression	[26]
Arteriosclerosis	DISK5QGC	moderate	Altered Expression	[27]
Atherosclerosis	DISMN9J3	moderate	Altered Expression	[27]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	moderate	Biomarker	[28]
Liver cancer	DISDE4BI	moderate	Biomarker	[28]
Osteoarthritis	DIS05URM	moderate	Altered Expression	[29]
Pulmonary fibrosis	DISQKVLA	moderate	Altered Expression	[30]
Gastric cancer	DISXGOUK	Disputed	Altered Expression	[31]
Non-small-cell lung cancer	DIS5Y6R9	Disputed	Altered Expression	[32]
Stomach cancer	DISKIJSX	Disputed	Altered Expression	[31]
Glioblastoma multiforme	DISK8246	Limited	Altered Expression	[26]
Prostate cancer	DISF190Y	Limited	Biomarker	[33]
Prostate carcinoma	DISMJPLE	Limited	Biomarker	[33]
Triple negative breast cancer	DISAMG6N	Limited	Altered Expression	[34]

6 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of ETS domain-containing protein Elk-1 (ELK1).	[35]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the phosphorylation of ETS domain-containing protein Elk-1 (ELK1).	[40]
Nicotine	DMWX5CO	Approved	Nicotine increases the phosphorylation of ETS domain-containing protein Elk-1 (ELK1).	[46]
Curcumin	DMQPH29	Phase 3	Curcumin increases the phosphorylation of ETS domain-containing protein Elk-1 (ELK1).	[51]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the phosphorylation of ETS domain-containing protein Elk-1 (ELK1).	[52]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of ETS domain-containing protein Elk-1 (ELK1).	[53]

18 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the activity of ETS domain-containing protein Elk-1 (ELK1).	[36]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of ETS domain-containing protein Elk-1 (ELK1).	[37]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of ETS domain-containing protein Elk-1 (ELK1).	[38]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of ETS domain-containing protein Elk-1 (ELK1).	[39]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of ETS domain-containing protein Elk-1 (ELK1).	[41]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of ETS domain-containing protein Elk-1 (ELK1).	[42]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of ETS domain-containing protein Elk-1 (ELK1).	[43]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the activity of ETS domain-containing protein Elk-1 (ELK1).	[44]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of ETS domain-containing protein Elk-1 (ELK1).	[45]
Rifampicin	DM5DSFZ	Approved	Rifampicin decreases the expression of ETS domain-containing protein Elk-1 (ELK1).	[47]
Mitotane	DMU1GX0	Approved	Mitotane increases the activity of ETS domain-containing protein Elk-1 (ELK1).	[48]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of ETS domain-containing protein Elk-1 (ELK1).	[49]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the activity of ETS domain-containing protein Elk-1 (ELK1).	[50]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the activity of ETS domain-containing protein Elk-1 (ELK1).	[48]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the activity of ETS domain-containing protein Elk-1 (ELK1).	[54]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal decreases the expression of ETS domain-containing protein Elk-1 (ELK1).	[41]
Butanoic acid	DMTAJP7	Investigative	Butanoic acid increases the activity of ETS domain-containing protein Elk-1 (ELK1).	[54]
Cycloheximide	DMGDA3C	Investigative	Cycloheximide increases the expression of ETS domain-containing protein Elk-1 (ELK1).	[55]

References

• [1] NDUFA4L2 is associated with clear cell renal cell carcinoma malignancy and is regulated by ELK1.PeerJ. 2017 Nov 17;5:e4065. doi: 10.7717/peerj.4065. eCollection 2017.
• [2] A systems biology approach to the global analysis of transcription factors in colorectal cancer.BMC Cancer. 2012 Aug 1;12:331. doi: 10.1186/1471-2407-12-331.
• [3] Elk-1 interacts with neuronal microtubules and relocalizes to the nucleus upon phosphorylation.Mol Cell Neurosci. 2009 Jan;40(1):111-9. doi: 10.1016/j.mcn.2008.10.004. Epub 2008 Oct 28.
• [4] Genome-wide characterization of lncRNAs in acute myeloid leukemia.Brief Bioinform. 2018 Jul 20;19(4):627-635. doi: 10.1093/bib/bbx007.
• [5] Suppression of Elk1 inhibits thyroid cancer progression by mediating PTEN expression.Oncol Rep. 2018 Sep;40(3):1769-1776. doi: 10.3892/or.2018.6554. Epub 2018 Jul 10.
• [6] Protein inhibitor of activated STAT1 Ser(503) phosphorylation-mediated Elk-1 SUMOylation promotes neuronal survival in APP/PS1 mice.Br J Pharmacol. 2019 Jun;176(11):1793-1810. doi: 10.1111/bph.14656. Epub 2019 Apr 24.
• [7] Expression of Phospho-ELK1 and Its Prognostic Significance in Urothelial Carcinoma of the Upper Urinary Tract.Int J Mol Sci. 2018 Mar 8;19(3):777. doi: 10.3390/ijms19030777.
• [8] ELK1-induced upregulation of long non-coding RNA MIR100HG predicts poor prognosis and promotes the progression of osteosarcoma by epigenetically silencing LATS1 and LATS2.Biomed Pharmacother. 2019 Jan;109:788-797. doi: 10.1016/j.biopha.2018.10.029. Epub 2018 Nov 5.
• [9] 15-Deoxy-12,14-prostaglandin J2 induces expression of 15-hydroxyprostaglandin dehydrogenase through Elk-1 activation in human breast cancer MDA-MB-231 cells.Mutat Res. 2014 Oct;768:6-15. doi: 10.1016/j.mrfmmm.2014.06.005. Epub 2014 Jun 24.
• [10] A feedback loop between androgen receptor and ERK signaling in estrogen receptor-negative breast cancer.Neoplasia. 2011 Feb;13(2):154-66. doi: 10.1593/neo.101324.
• [11] LncRNA TDRG1 functions as an oncogene in cervical cancer through sponging miR-330-5p to modulate ELK1 expression.Eur Rev Med Pharmacol Sci. 2019 Sep;23(17):7295-7306. doi: 10.26355/eurrev_201909_18834.
• [12] A network-based analysis of colon cancer splicing changes reveals a tumorigenesis-favoring regulatory pathway emanating from ELK1.Genome Res. 2016 Apr;26(4):541-53. doi: 10.1101/gr.193169.115. Epub 2016 Feb 9.
• [13] Antidepressive effects of targeting ELK-1 signal transduction.Nat Med. 2018 May;24(5):591-597. doi: 10.1038/s41591-018-0011-0. Epub 2018 May 7.
• [14] NF-B1, c-Rel, and ELK1 inhibit miR-134 expression leading to TAB1 upregulation in paclitaxel-resistant human ovarian cancer.Oncotarget. 2017 Apr 11;8(15):24853-24868. doi: 10.18632/oncotarget.15267.
• [15] Overexpression of Ets-like protein 1 in human esophageal squamous cell carcinoma.World J Gastroenterol. 2006 Dec 28;12(48):7859-63. doi: 10.3748/wjg.v12.i48.7859.
• [16] PSMB8-AS1 activated by ELK1 promotes cell proliferation in glioma via regulating miR-574-5p/RAB10.Biomed Pharmacother. 2020 Feb;122:109658. doi: 10.1016/j.biopha.2019.109658. Epub 2019 Dec 4.
• [17] MiR-185-5p suppresses HBV gene expression by targeting ELK1 in hepatoma carcinoma cells.Life Sci. 2018 Nov 15;213:9-17. doi: 10.1016/j.lfs.2018.10.016. Epub 2018 Oct 9.
• [18] MZF-1/Elk-1/PKC is Associated with Poor Prognosis in Patients with Hepatocellular Carcinoma.J Cancer. 2017 Sep 2;8(15):3028-3036. doi: 10.7150/jca.20467. eCollection 2017.
• [19] Early epigenomic and transcriptional changes reveal Elk-1 transcription factor as a therapeutic target in Huntington's disease.Proc Natl Acad Sci U S A. 2019 Dec 3;116(49):24840-24851. doi: 10.1073/pnas.1908113116. Epub 2019 Nov 19.
• [20] ELK1-induced upregulation of lncRNA HOXA10-AS promotes lung adenocarcinoma progression by increasing Wnt/-catenin signaling.Biochem Biophys Res Commun. 2018 Jun 27;501(3):612-618. doi: 10.1016/j.bbrc.2018.04.224.
• [21] Selective requirement for Mediator MED23 in Ras-active lung cancer.Proc Natl Acad Sci U S A. 2012 Oct 9;109(41):E2813-22. doi: 10.1073/pnas.1204311109. Epub 2012 Sep 17.
• [22] GRP receptor-mediated immediate early gene expression and transcription factor Elk-1 activation in prostate cancer cells.Regul Pept. 2002 Nov 15;109(1-3):141-8. doi: 10.1016/s0167-0115(02)00197-0.
• [23] Refined mapping of the human Ets-related gene Elk-1 to Xp11.2-p11.4, distal to the OATL1 region.Hum Genet. 1994 Oct;94(4):442-4. doi: 10.1007/BF00201610.
• [24] Preferential binding to Elk-1 by SLE-associated IL10 risk allele upregulates IL10 expression.PLoS Genet. 2013;9(10):e1003870. doi: 10.1371/journal.pgen.1003870. Epub 2013 Oct 10.
• [25] Expression of protein kinase C and the MZF-1 and elk-1 transcription factors in human bladder transitional cell carcinoma cells.Chin J Physiol. 2012 Apr 30;55(2):75-81. doi: 10.4077/CJP.2012.AMM121.
• [26] Both mitogen-activated protein kinase (MAPK)/extracellular-signal-regulated kinases (ERK) 1/2 and phosphatidylinositide-3-OH kinase (PI3K)/Akt pathways regulate activation of E-twenty-six (ETS)-like transcription factor 1 (Elk-1) in U138 glioblastoma cells.Int J Biochem Cell Biol. 2012 Feb;44(2):302-10. doi: 10.1016/j.biocel.2011.10.025. Epub 2011 Nov 7.
• [27] Heat shock protein 70 accelerates atherosclerosis by downregulating the expression of ABCA1 and ABCG1 through the JNK/Elk-1 pathway.Biochim Biophys Acta Mol Cell Biol Lipids. 2018 Aug;1863(8):806-822. doi: 10.1016/j.bbalip.2018.04.011. Epub 2018 Apr 17.
• [28] Antisense oligonucleotide Elk-1 suppresses the tumorigenicity of human hepatocellular carcinoma cells.Cell Biol Int. 2008 Feb;32(2):210-6. doi: 10.1016/j.cellbi.2007.08.027. Epub 2007 Sep 7.
• [29] Nrf2/ARE pathway attenuates oxidative and apoptotic response in human osteoarthritis chondrocytes by activating ERK1/2/ELK1-P70S6K-P90RSK signaling axis.Free Radic Biol Med. 2018 Feb 20;116:159-171. doi: 10.1016/j.freeradbiomed.2018.01.013. Epub 2018 Jan 12.
• [30] The effects of atorvastatin on the kidney injury in mice with pulmonary fibrosis.J Pharm Pharmacol. 2019 Aug;71(8):1301-1310. doi: 10.1111/jphp.13128. Epub 2019 Jun 18.
• [31] ELK1-induced upregulation of lncRNA TRPM2-AS promotes tumor progression in gastric cancer by regulating miR-195/ HMGA1 axis.J Cell Biochem. 2019 Oct;120(10):16921-16933. doi: 10.1002/jcb.28951. Epub 2019 May 19.
• [32] PLEK2 mediates metastasis and vascular invasion via the ubiquitin-dependent degradation of SHIP2 in non-small cell lung cancer.Int J Cancer. 2020 May 1;146(9):2563-2575. doi: 10.1002/ijc.32675. Epub 2019 Nov 6.
• [33] The ternary complex factor protein ELK1 is an independent prognosticator of disease recurrence in prostate cancer.Prostate. 2020 Feb;80(2):198-208. doi: 10.1002/pros.23932. Epub 2019 Dec 3.
• [34] Myeloid Zinc Finger 1 (MZF1) Maintains the Mesenchymal Phenotype by Down-regulating IGF1R/p38 MAPK/ER Signaling Pathway in High-level MZF1-expressing TNBC cells.Anticancer Res. 2019 Aug;39(8):4149-4164. doi: 10.21873/anticanres.13574.
• [35] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [36] Activation of the EGF receptor signaling pathway in human airway epithelial cells exposed to metals. Am J Physiol. 1999 Nov;277(5):L924-31. doi: 10.1152/ajplung.1999.277.5.L924.
• [37] Estrogen Regulates MAPK-Related Genes through Genomic and Nongenomic Interactions between IGF-I Receptor Tyrosine Kinase and Estrogen Receptor-Alpha Signaling Pathways in Human Uterine Leiomyoma Cells. J Signal Transduct. 2012;2012:204236. doi: 10.1155/2012/204236. Epub 2012 Oct 9.
• [38] Quercetin and Cisplatin combined treatment altered cell cycle and mitogen activated protein kinase expressions in malignant mesotelioma cells. BMC Complement Altern Med. 2016 Aug 11;16(1):281. doi: 10.1186/s12906-016-1267-x.
• [39] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [40] Arsenite-induced downregulation of occludin in mouse lungs and BEAS-2B cells via the ROS/ERK/ELK1/MLCK and ROS/p38 MAPK signaling pathways. Toxicol Lett. 2020 Oct 10;332:146-154. doi: 10.1016/j.toxlet.2020.07.010. Epub 2020 Jul 16.
• [41] Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
• [42] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [43] Cannabidiol and Oxygen-Ozone Combination Induce Cytotoxicity in Human Pancreatic Ductal Adenocarcinoma Cell Lines. Cancers (Basel). 2020 Sep 27;12(10):2774. doi: 10.3390/cancers12102774.
• [44] Troglitazone activates p21Cip/WAF1 through the ERK pathway in HCT15 human colorectal cancer cells. Cancer Lett. 2002 May 28;179(2):185-95. doi: 10.1016/s0304-3835(01)00869-2.
• [45] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [46] nAChRs-ERK1/2-Egr-1 signaling participates in the developmental toxicity of nicotine by epigenetically down-regulating placental 11beta-HSD2. Toxicol Appl Pharmacol. 2018 Apr 1;344:1-12.
• [47] Integrated analysis of rifampicin-induced microRNA and gene expression changes in human hepatocytes. Drug Metab Pharmacokinet. 2014;29(4):333-40.
• [48] Organochlorine-mediated potentiation of the general coactivator p300 through p38 mitogen-activated protein kinase. Carcinogenesis. 2009 Jan;30(1):106-13. doi: 10.1093/carcin/bgn213. Epub 2008 Sep 12.
• [49] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [50] Resveratrol upregulates Egr-1 expression and activity involving extracellular signal-regulated protein kinase and ternary complex factors. Exp Cell Res. 2015 Mar 1;332(1):116-27. doi: 10.1016/j.yexcr.2015.01.013. Epub 2015 Jan 30.
• [51] p21 Waf1/Cip1 expression by curcumin in U-87MG human glioma cells: role of early growth response-1 expression. Cancer Res. 2008 Mar 1;68(5):1369-77. doi: 10.1158/0008-5472.CAN-07-5222.
• [52] Activation of extracellular signal-regulated kinase and c-Jun-NH(2)-terminal kinase but not p38 mitogen-activated protein kinases is required for RRR-alpha-tocopheryl succinate-induced apoptosis of human breast cancer cells. Cancer Res. 2001 Sep 1;61(17):6569-76.
• [53] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [54] Short-chain fatty acids enhance nuclear receptor activity through mitogen-activated protein kinase activation and histone deacetylase inhibition. Proc Natl Acad Sci U S A. 2004 May 4;101(18):7199-204.
• [55] Comparative analysis of AhR-mediated TCDD-elicited gene expression in human liver adult stem cells. Toxicol Sci. 2009 Nov;112(1):229-44.