Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHIHI9D)

DOT Name	1-aminocyclopropane-1-carboxylate synthase-like protein 1 (ACCS)
Synonyms	ACC synthase-like protein 1
Gene Name	ACCS
Related Disease	Acute lymphocytic leukaemia ( ) Acute myocardial infarction ( ) Alzheimer disease ( ) Appendicitis ( ) Arteriosclerosis ( ) Atherosclerosis ( ) Atrial fibrillation ( ) Breast cancer ( ) Carcinoma of esophagus ( ) Cardiac arrest ( ) Childhood acute lymphoblastic leukemia ( ) Chronic kidney disease ( ) Clear cell renal carcinoma ( ) Colorectal carcinoma ( ) Congestive heart failure ( ) Coronary atherosclerosis ( ) Coronary heart disease ( ) Depression ( ) Diabetic kidney disease ( ) Esophageal cancer ( ) High blood pressure ( ) Inflammatory bowel disease ( ) Myocardial infarction ( ) Neoplasm ( ) Neoplasm of esophagus ( ) Neuroendocrine neoplasm ( ) Obesity ( ) Obstructive sleep apnea ( ) Prostate cancer ( ) Prostate carcinoma ( ) Rectal carcinoma ( ) Renal cell carcinoma ( ) Squamous cell carcinoma ( ) Stroke ( ) Venous thromboembolism ( ) Cardiovascular disease ( ) Colon cancer ( ) Colon carcinoma ( ) Crohn disease ( ) IgA nephropathy ( ) Endometrial cancer ( ) Endometrial carcinoma ( ) Abdominal aortic aneurysm ( ) Advanced cancer ( ) Breast carcinoma ( ) Chronic obstructive pulmonary disease ( ) Hepatocellular carcinoma ( )
UniProt ID	1A1L1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00155
Sequence	MFTLPQKDFRAPTTCLGPTCMQDLGSSHGEDLEGECSRKLDQKLPELRGVGDPAMISSDT SYLSSRGRMIKWFWDSAEEGYRTYHMDEYDEDKNPSGIINLGTSENKLCFDLLSWRLSQR DMQRVEPSLLQYADWRGHLFLREEVAKFLSFYCKSPVPLRPENVVVLNGGASLFSALATV LCEAGEAFLIPTPYYGAITQHVCLYGNIRLAYVYLDSEVTGLDTRPFQLTVEKLEMALRE AHSEGVKVKGLILISPQNPLGDVYSPEELQEYLVFAKRHRLHVIVDEVYMLSVFEKSVGY RSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGTLYTENQDVATAVASLCRYHGLSGLVQ YQMAQLLRDRDWINQVYLPENHARLKAAHTYVSEELRALGIPFLSRGAGFFIWVDLRKYL PKGTFEEEMLLWRRFLDNKVLLSFGKAFECKEPGWFRFVFSDQVHRLCLGMQRVQQVLAG KSQVAEDPRPSQSQEPSDQRR
Function	Does not catalyze the synthesis of 1-aminocyclopropane-1-carboxylate but is capable of catalyzing the deamination of L-vinylglycine.

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Acute lymphocytic leukaemia	DISPX75S	Strong	Genetic Variation	[1]
Acute myocardial infarction	DISE3HTG	Strong	Biomarker	[2]
Alzheimer disease	DISF8S70	Strong	Biomarker	[3]
Appendicitis	DIS4GOLF	Strong	Genetic Variation	[4]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[5]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[5]
Atrial fibrillation	DIS15W6U	Strong	Biomarker	[6]
Breast cancer	DIS7DPX1	Strong	Biomarker	[7]
Carcinoma of esophagus	DISS6G4D	Strong	Biomarker	[8]
Cardiac arrest	DIS9DIA4	Strong	Biomarker	[9]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Strong	Genetic Variation	[1]
Chronic kidney disease	DISW82R7	Strong	Biomarker	[10]
Clear cell renal carcinoma	DISBXRFJ	Strong	Genetic Variation	[11]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[12]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[13]
Coronary atherosclerosis	DISKNDYU	Strong	Genetic Variation	[14]
Coronary heart disease	DIS5OIP1	Strong	Biomarker	[15]
Depression	DIS3XJ69	Strong	Biomarker	[16]
Diabetic kidney disease	DISJMWEY	Strong	Altered Expression	[17]
Esophageal cancer	DISGB2VN	Strong	Biomarker	[8]
High blood pressure	DISY2OHH	Strong	Genetic Variation	[18]
Inflammatory bowel disease	DISGN23E	Strong	Biomarker	[19]
Myocardial infarction	DIS655KI	Strong	Biomarker	[20]
Neoplasm	DISZKGEW	Strong	Biomarker	[21]
Neoplasm of esophagus	DISOLKAQ	Strong	Biomarker	[8]
Neuroendocrine neoplasm	DISNPLOO	Strong	Biomarker	[22]
Obesity	DIS47Y1K	Strong	Genetic Variation	[23]
Obstructive sleep apnea	DIS0SVD1	Strong	Biomarker	[24]
Prostate cancer	DISF190Y	Strong	Biomarker	[25]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[25]
Rectal carcinoma	DIS8FRR7	Strong	Genetic Variation	[26]
Renal cell carcinoma	DISQZ2X8	Strong	Genetic Variation	[11]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[27]
Stroke	DISX6UHX	Strong	Biomarker	[28]
Venous thromboembolism	DISUR7CR	Strong	Biomarker	[29]
Cardiovascular disease	DIS2IQDX	moderate	Biomarker	[30]
Colon cancer	DISVC52G	moderate	Biomarker	[31]
Colon carcinoma	DISJYKUO	moderate	Biomarker	[31]
Crohn disease	DIS2C5Q8	moderate	Genetic Variation	[32]
IgA nephropathy	DISZ8MTK	moderate	Genetic Variation	[33]
Endometrial cancer	DISW0LMR	Disputed	Biomarker	[34]
Endometrial carcinoma	DISXR5CY	Disputed	Biomarker	[34]
Abdominal aortic aneurysm	DISD06OF	Limited	Biomarker	[35]
Advanced cancer	DISAT1Z9	Limited	Genetic Variation	[36]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[7]
Chronic obstructive pulmonary disease	DISQCIRF	Limited	Biomarker	[37]
Hepatocellular carcinoma	DIS0J828	Limited	Biomarker	[38]
------------------------------------------------------------------------------------


⏷ Show the Full List of 47 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of 1-aminocyclopropane-1-carboxylate synthase-like protein 1 (ACCS).	[39]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of 1-aminocyclopropane-1-carboxylate synthase-like protein 1 (ACCS).	[40]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of 1-aminocyclopropane-1-carboxylate synthase-like protein 1 (ACCS).	[40]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of 1-aminocyclopropane-1-carboxylate synthase-like protein 1 (ACCS).	[41]
------------------------------------------------------------------------------------

References

1	Development of Escherichia coli Asparaginase II for Immunosensing: A Trade-Off between Receptor Density and Sensing Efficiency.ACS Omega. 2017 May 31;2(5):2114-2125. doi: 10.1021/acsomega.7b00110. Epub 2017 May 17.
2	Predictive value of the Canada Acute Coronary Syndrome risk score for post-acute myocardial infarction infection.Eur J Intern Med. 2020 Jan;71:57-61. doi: 10.1016/j.ejim.2019.10.012. Epub 2019 Nov 12.
3	Preclinical Development of Crocus sativus-Based Botanical Lead IIIM-141 for Alzheimer's Disease: Chemical Standardization, Efficacy, Formulation Development, Pharmacokinetics, and Safety Pharmacology.ACS Omega. 2018 Aug 20;3(8):9572-9585. doi: 10.1021/acsomega.8b00841. eCollection 2018 Aug 31.
4	Imaging utilization affects negative appendectomy rates in appendicitis: An ACS-NSQIP study.Am J Surg. 2019 Jun;217(6):1094-1098. doi: 10.1016/j.amjsurg.2018.12.072. Epub 2019 Jan 3.
5	Association of Serum Cholesterol Ester Transfer Protein Levels with Taq IB Polymorphism in Acute Coronary Syndrome.Lab Med. 2020 Mar 10;51(2):199-210. doi: 10.1093/labmed/lmz043.
6	Stent Thrombosis in Patients With Atrial Fibrillation Undergoing Coronary Stenting in the AUGUSTUS Trial.Circulation. 2020 Mar 3;141(9):781-783. doi: 10.1161/CIRCULATIONAHA.119.044584. Epub 2019 Nov 11.
7	Breast cancer survivorship: state of the science.Breast Cancer Res Treat. 2018 Apr;168(3):593-600. doi: 10.1007/s10549-017-4650-5. Epub 2018 Jan 13.
8	The effects of neoadjuvant therapy on morbidity and mortality of esophagectomy for esophageal cancer: American college of surgeons national surgical quality improvement program (ACS-NSQIP) 2005-2012.J Surg Oncol. 2017 Mar;115(3):296-300. doi: 10.1002/jso.24493. Epub 2016 Nov 4.
9	Editor's Choice-Prospective registry of cardiac critical illness in a modern tertiary care Cardiac Intensive Care Unit.Eur Heart J Acute Cardiovasc Care. 2019 Dec;8(8):755-761. doi: 10.1177/2048872618789053. Epub 2018 Jul 23.
10	Impact of serum albumin levels on long-term outcomes in patients undergoing percutaneous coronary intervention.Heart Vessels. 2017 Sep;32(9):1085-1092. doi: 10.1007/s00380-017-0981-8. Epub 2017 Apr 20.
11	Predicted versus observed 30-day perioperative outcomes using the ACS NSQIP surgical risk calculator in patients undergoing partial nephrectomy for renal cell carcinoma.Int Urol Nephrol. 2018 Jul;50(7):1249-1256. doi: 10.1007/s11255-018-1898-6. Epub 2018 Jun 4.
12	Associations of Pre- and Postdiagnosis Diet Quality With Risk of Mortality Among Men and Women With Colorectal Cancer.J Clin Oncol. 2018 Oct 19;36(34):JCO1800714. doi: 10.1200/JCO.18.00714. Online ahead of print.
13	Early versus delayed invasive strategy in patients with non-ST-elevation acute coronary syndrome and concomitant congestive heart failure.J Cardiol. 2019 Oct;74(4):320-327. doi: 10.1016/j.jjcc.2019.03.006.
14	Comparison of Outcomes After Percutaneous Coronary Intervention in Elderly Patients, Including 10628 Nonagenarians: Insights From a Japanese Nationwide Registry (J-PCI Registry).J Am Heart Assoc. 2019 Mar 5;8(5):e011183. doi: 10.1161/JAHA.118.011017.
15	Predictive value of global and territorial longitudinal strain imaging in detecting significant coronary artery disease in patients with myocardial infarction without persistent ST-segment elevation.Echocardiography. 2019 Mar;36(3):512-520. doi: 10.1111/echo.14275. Epub 2019 Feb 25.
16	Impact of depression at early and late phases following acute coronary syndrome on long-term cardiac outcomes.J Affect Disord. 2020 Jan 1;260:592-596. doi: 10.1016/j.jad.2019.09.059. Epub 2019 Sep 12.
17	Resveratrol reverts Streptozotocin-induced diabetic nephropathy.Front Biosci (Landmark Ed). 2020 Jan 1;25(4):699-709. doi: 10.2741/4829.
18	First-in-man study of dedicated bifurcation cobalt-chromium sirolimus-eluting stent BiOSS LIM C - three-month results.Kardiol Pol. 2018;76(2):464-470. doi: 10.5603/KP.a2017.0226. Epub 2017 Dec 1.
19	The ACS National Surgical Quality Improvement Program-Inflammatory Bowel Disease Collaborative: Design, Implementation, and Validation of a Disease-specific Module.Inflamm Bowel Dis. 2019 Oct 18;25(11):1731-1739. doi: 10.1093/ibd/izz044.
20	Variability in High-Sensitivity Cardiac Troponin T Testing in Stable Patients With and Without Coronary Artery Disease.Can J Cardiol. 2019 Nov;35(11):1505-1512. doi: 10.1016/j.cjca.2019.08.022. Epub 2019 Aug 22.
21	The Effect of Underlying Liver Disease on Perioperative Outcomes Following Craniotomy for Tumor: An American College of Surgeons National Quality Improvement Program Analysis.World Neurosurg. 2018 Jul;115:e85-e96. doi: 10.1016/j.wneu.2018.03.183. Epub 2018 Apr 3.
22	Do All Abdominal Neuroendocrine Tumors Require Extended Postoperative VTE Prophylaxis? A NSQIP Analysis.J Gastrointest Surg. 2019 Apr;23(4):788-793. doi: 10.1007/s11605-018-04075-y. Epub 2019 Jan 22.
23	Outcomes in Cardiogenic Shock from Acute Coronary Syndrome Depending on Severity of Obesity.Am J Cardiol. 2019 Apr 15;123(8):1267-1272. doi: 10.1016/j.amjcard.2019.01.010. Epub 2019 Jan 24.
24	Association of Obstructive Sleep Apnea With Cardiovascular Outcomes in Patients With Acute Coronary Syndrome.J Am Heart Assoc. 2019 Jan 22;8(2):e010826. doi: 10.1161/JAHA.118.010826.
25	Modified frailty index associated with Clavien-Dindo IV complications in robot-assisted radical prostatectomies: A retrospective study.Urol Oncol. 2017 Jun;35(6):425-431. doi: 10.1016/j.urolonc.2017.01.005. Epub 2017 Feb 9.
26	Trends and outcomes in laparoscopic versus open surgery for rectal cancer from 2005 to 2016 using the ACS-NSQIP database, a retrospective cohort study.Int J Surg. 2019 Mar;63:71-76. doi: 10.1016/j.ijsu.2019.02.006. Epub 2019 Feb 13.
27	Tyrosine-kinase inhibition results in EGFR clustering at focal adhesions and consequent exocytosis in uPAR down-regulated cells of head and neck cancers.Mol Cancer. 2008 Jun 3;7:47. doi: 10.1186/1476-4598-7-47.
28	Influence of Environmental Factors on Social Participation Post-Stroke.Behav Neurol. 2019 Jan 16;2019:2606039. doi: 10.1155/2019/2606039. eCollection 2019.
29	Is Obesity Associated With Increased Risk of Deep Vein Thrombosis or Pulmonary Embolism After Hip and Knee Arthroplasty? A Large Database Study.Clin Orthop Relat Res. 2019 Mar;477(3):523-532. doi: 10.1097/CORR.0000000000000615.
30	Performance on management strategies with Class I Recommendation and A Level of Evidence among hospitalized patients with non-ST-segment elevation acute coronary syndrome in China: Findings from the Improving Care for Cardiovascular Disease in China-Acute Coronary Syndrome (CCC-ACS) project.Am Heart J. 2019 Jun;212:80-90. doi: 10.1016/j.ahj.2019.02.012. Epub 2019 Mar 4.
31	Association of Survival With Adherence to the American Cancer Society Nutrition and Physical Activity Guidelines for Cancer Survivors After Colon Cancer Diagnosis: The CALGB 89803/Alliance Trial.JAMA Oncol. 2018 Jun 1;4(6):783-790. doi: 10.1001/jamaoncol.2018.0126.
32	Immunosuppressed Patients with Crohn's Disease Are at Increased Risk of Postoperative Complications: Results from the ACS-NSQIP Database.J Gastrointest Surg. 2019 Jun;23(6):1188-1197. doi: 10.1007/s11605-019-04186-0. Epub 2019 Mar 18.
33	Identification of new susceptibility loci for IgA nephropathy in Han Chinese.Nat Commun. 2015 Jun 1;6:7270. doi: 10.1038/ncomms8270.
34	Preoperative frailty is a risk factor for non-home discharge in patients undergoing surgery for endometrial cancer.J Geriatr Oncol. 2018 Sep;9(5):513-515. doi: 10.1016/j.jgo.2018.02.005. Epub 2018 Mar 9.
35	Development and Validation of Procedure-Specific Risk Score for Predicting Postoperative Pulmonary Complication: ANSQIP Analysis.J Am Coll Surg. 2019 Oct;229(4):355-365.e3. doi: 10.1016/j.jamcollsurg.2019.05.028. Epub 2019 Jun 18.
36	Association of preoperative biliary drainage technique with postoperative outcomes among patients with resectable hepatobiliary malignancy.HPB (Oxford). 2020 Feb;22(2):249-257. doi: 10.1016/j.hpb.2019.06.011. Epub 2019 Jul 23.
37	Early Invasive Versus Ischemia-Guided Strategy in Non-ST-Segment Elevation Acute Coronary Syndrome With Chronic Obstructive Pulmonary Disease: A National Inpatient Sample Analysis.Angiology. 2020 Apr;71(4):372-379. doi: 10.1177/0003319719877096. Epub 2019 Oct 2.
38	Evaluation of the ACS NSQIP Surgical Risk Calculator in Elderly Patients Undergoing Hepatectomy for Hepatocellular Carcinoma.J Gastrointest Surg. 2020 Mar;24(3):551-559. doi: 10.1007/s11605-019-04174-4. Epub 2019 Apr 1.
39	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
40	Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
41	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.