Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTI2EYO6)

DOT Name E3 ubiquitin-protein ligase MARCHF1 (MARCHF1)
Synonyms EC 2.3.2.27; Membrane-associated RING finger protein 1; Membrane-associated RING-CH protein I; MARCH-I; RING finger protein 171; RING-type E3 ubiquitin transferase MARCHF1
Gene Name MARCHF1
Related Disease
Epilepsy ( )
Melanoma ( )
Type-1/2 diabetes ( )
Acute myocardial infarction ( )
Advanced cancer ( )
Allergic asthma ( )
Autoimmune disease ( )
Carcinoma of esophagus ( )
Carcinoma of liver and intrahepatic biliary tract ( )
Cardiac failure ( )
Cervical cancer ( )
Cervical carcinoma ( )
Chronic kidney disease ( )
Congestive heart failure ( )
Coronary heart disease ( )
Crohn disease ( )
Cystic fibrosis ( )
Gastric cancer ( )
Hepatocellular carcinoma ( )
Inflammatory bowel disease ( )
Liver cancer ( )
Multiple sclerosis ( )
Myelodysplastic syndrome ( )
Neoplasm ( )
Non-small-cell lung cancer ( )
Obesity ( )
Pneumonia ( )
Prostate cancer ( )
Prostate carcinoma ( )
Schizophrenia ( )
Stomach cancer ( )
Stroke ( )
Thrombophilia ( )
Ulcerative colitis ( )
Venous thromboembolism ( )
Bladder cancer ( )
Colorectal carcinoma ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
Rheumatoid arthritis ( )
Asthma ( )
Bone osteosarcoma ( )
Hepatitis C virus infection ( )
Metastatic malignant neoplasm ( )
Non-insulin dependent diabetes ( )
Osteosarcoma ( )
Small lymphocytic lymphoma ( )
UniProt ID
MARH1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
2.3.2.27
Pfam ID
PF12906
Sequence
MLGWCEAIARNPHRIPNNTRTPEISGDLADASQTSTLNEKSPGRSASRSSNISKASSPTT
GTAPRSQSRLSVCPSTQDICRICHCEGDEESPLITPCRCTGTLRFVHQSCLHQWIKSSDT
RCCELCKYDFIMETKLKPLRKWEKLQMTTSERRKIFCSVTFHVIAITCVVWSLYVLIDRT
AEEIKQGNDNGVLEWPFWTKLVVVAIGFTGGLVFMYVQCKVYVQLWRRLKAYNRVIFVQN
CPDTAKKLEKNFSCNVNTDIKDAVVVPVPQTGANSLPSAEGGPPEVVSV
Function
E3 ubiquitin-protein ligase that mediates ubiquitination of TFRC, CD86, FAS and MHC class II proteins, such as HLA-DR alpha and beta, and promotes their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. By constitutively ubiquitinating MHC class II proteins in immature dendritic cells, down-regulates their cell surface localization thus sequestering them in the intracellular endosomal system.
Tissue Specificity
Expressed in antigen presenting cells, APCs, located in lymph nodes and spleen. Also expressed in lung. Expression is high in follicular B-cells, moderate in dendritic cells and low in splenic T-cells.

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Epilepsy DISBB28L Definitive Genetic Variation [1]
Melanoma DIS1RRCY Definitive Genetic Variation [2]
Type-1/2 diabetes DISIUHAP Definitive Biomarker [3]
Acute myocardial infarction DISE3HTG Strong Biomarker [4]
Advanced cancer DISAT1Z9 Strong Genetic Variation [5]
Allergic asthma DISHF0H3 Strong Biomarker [6]
Autoimmune disease DISORMTM Strong Biomarker [7]
Carcinoma of esophagus DISS6G4D Strong Genetic Variation [8]
Carcinoma of liver and intrahepatic biliary tract DIS8WA0W Strong Biomarker [9]
Cardiac failure DISDC067 Strong Biomarker [10]
Cervical cancer DISFSHPF Strong Altered Expression [11]
Cervical carcinoma DIST4S00 Strong Altered Expression [11]
Chronic kidney disease DISW82R7 Strong Genetic Variation [12]
Congestive heart failure DIS32MEA Strong Biomarker [10]
Coronary heart disease DIS5OIP1 Strong Biomarker [13]
Crohn disease DIS2C5Q8 Strong Biomarker [14]
Cystic fibrosis DIS2OK1Q Strong Biomarker [15]
Gastric cancer DISXGOUK Strong Genetic Variation [16]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [17]
Inflammatory bowel disease DISGN23E Strong Genetic Variation [18]
Liver cancer DISDE4BI Strong Biomarker [9]
Multiple sclerosis DISB2WZI Strong Genetic Variation [19]
Myelodysplastic syndrome DISYHNUI Strong Biomarker [20]
Neoplasm DISZKGEW Strong Biomarker [17]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [21]
Obesity DIS47Y1K Strong Altered Expression [22]
Pneumonia DIS8EF3M Strong Genetic Variation [23]
Prostate cancer DISF190Y Strong Genetic Variation [24]
Prostate carcinoma DISMJPLE Strong Genetic Variation [24]
Schizophrenia DISSRV2N Strong Genetic Variation [25]
Stomach cancer DISKIJSX Strong Genetic Variation [16]
Stroke DISX6UHX Strong Biomarker [26]
Thrombophilia DISQR7U7 Strong Genetic Variation [27]
Ulcerative colitis DIS8K27O Strong Biomarker [14]
Venous thromboembolism DISUR7CR Strong Biomarker [27]
Bladder cancer DISUHNM0 moderate Biomarker [28]
Colorectal carcinoma DIS5PYL0 moderate Biomarker [29]
Urinary bladder cancer DISDV4T7 moderate Biomarker [28]
Urinary bladder neoplasm DIS7HACE moderate Biomarker [28]
Rheumatoid arthritis DISTSB4J Disputed Biomarker [30]
Asthma DISW9QNS Limited Biomarker [31]
Bone osteosarcoma DIST1004 Limited Biomarker [32]
Hepatitis C virus infection DISQ0M8R Limited Genetic Variation [33]
Metastatic malignant neoplasm DIS86UK6 Limited Genetic Variation [34]
Non-insulin dependent diabetes DISK1O5Z Limited Biomarker [35]
Osteosarcoma DISLQ7E2 Limited Biomarker [32]
Small lymphocytic lymphoma DIS30POX Limited Biomarker [36]
------------------------------------------------------------------------------------
⏷ Show the Full List of 47 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate affects the expression of E3 ubiquitin-protein ligase MARCHF1 (MARCHF1). [37]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of E3 ubiquitin-protein ligase MARCHF1 (MARCHF1). [38]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of E3 ubiquitin-protein ligase MARCHF1 (MARCHF1). [39]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of E3 ubiquitin-protein ligase MARCHF1 (MARCHF1). [41]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of E3 ubiquitin-protein ligase MARCHF1 (MARCHF1). [37]
Choline DM5D9YK Investigative Choline affects the expression of E3 ubiquitin-protein ligase MARCHF1 (MARCHF1). [43]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of E3 ubiquitin-protein ligase MARCHF1 (MARCHF1). [40]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of E3 ubiquitin-protein ligase MARCHF1 (MARCHF1). [42]
------------------------------------------------------------------------------------

References

1 Comparative Effectiveness of Levetiracetam vs Phenobarbital for Infantile Epilepsy.JAMA Pediatr. 2018 Apr 1;172(4):352-360. doi: 10.1001/jamapediatrics.2017.5211.
2 Association of Time From Primary Diagnosis to First Distant Relapse of Metastatic Melanoma With Progression of Disease and Survival.JAMA Dermatol. 2019 Jun 1;155(6):673-678. doi: 10.1001/jamadermatol.2019.0425.
3 Effect of Home Enteral Nutrition on Diabetes and Its Management.Nutr Clin Pract. 2019 Apr;34(2):250-256. doi: 10.1002/ncp.10104. Epub 2018 Jul 13.
4 Comparison of Platelet Function Guided Versus Unguided Treatment With P2Y12 Inhibitors in Patients With Acute Myocardial Infarction (from the Hungarian Myocardial Infarction Registry).Am J Cardiol. 2018 May 15;121(10):1129-1137. doi: 10.1016/j.amjcard.2018.01.032. Epub 2018 Feb 13.
5 Using patient-reported religious/spiritual concerns to identify patients who accept chaplain interventions in an outpatient oncology setting.Support Care Cancer. 2019 May;27(5):1861-1869. doi: 10.1007/s00520-018-4447-z. Epub 2018 Sep 6.
6 March1 E3 Ubiquitin Ligase Modulates Features of Allergic Asthma in an Ovalbumin-Induced Mouse Model of Lung Inflammation.J Immunol Res. 2018 May 3;2018:3823910. doi: 10.1155/2018/3823910. eCollection 2018.
7 Vasculitic and autoimmune wounds.J Vasc Surg Venous Lymphat Disord. 2017 Mar;5(2):280-292. doi: 10.1016/j.jvsv.2016.09.006. Epub 2016 Dec 14.
8 Selective En Masse Ligation of the ThoracicDuct to Prevent Chyle Leak AfterEsophagectomy.Ann Thorac Surg. 2017 Jun;103(6):1802-1807. doi: 10.1016/j.athoracsur.2017.01.025. Epub 2017 Apr 3.
9 Secalonic Acid-F, a Novel Mycotoxin, Represses the Progression of Hepatocellular Carcinoma via MARCH1 Regulation of the PI3K/AKT/-catenin Signaling Pathway.Molecules. 2019 Jan 22;24(3):393. doi: 10.3390/molecules24030393.
10 Hemodynamic Assessment of Patients With and Without Heart Failure Symptoms Supported by a Continuous-Flow Left Ventricular Assist Device.Mayo Clin Proc. 2018 Jul;93(7):895-903. doi: 10.1016/j.mayocp.2018.01.031. Epub 2018 Jun 19.
11 The possible association between the presence of an MPO -463 G?A (rs2333227) polymorphism and cervical cancer risk.Pathol Res Pract. 2018 Aug;214(8):1142-1148. doi: 10.1016/j.prp.2018.05.018. Epub 2018 May 22.
12 Cardiovascular risk of sitagliptin in ischemic stroke patients with type 2 diabetes and chronic kidney disease: A nationwide cohort study.Medicine (Baltimore). 2018 Dec;97(52):e13844. doi: 10.1097/MD.0000000000013844.
13 Risk factors for first-time acute myocardial infarction patients in Trinidad.BMC Public Health. 2018 Jan 19;18(1):161. doi: 10.1186/s12889-018-5080-y.
14 The Incidence and Definition of Crohn's Disease of the Pouch: A Systematic Review and Meta-analysis.Inflamm Bowel Dis. 2019 Aug 20;25(9):1474-1480. doi: 10.1093/ibd/izz005.
15 Implementation of newborn screening for cystic fibrosis in Norway. Results from the first three years.J Cyst Fibros. 2016 May;15(3):318-24. doi: 10.1016/j.jcf.2015.12.017. Epub 2016 Jan 12.
16 Risk of stomach cancer in relation to consumption of cigarettes, alcohol, tea and coffee in Warsaw, Poland.Int J Cancer. 1999 Jun 11;81(6):871-6. doi: 10.1002/(sici)1097-0215(19990611)81:6<871::aid-ijc6>3.0.co;2-#.
17 MARCH1 encourages tumour progression of hepatocellular carcinoma via regulation of PI3K-AKT--catenin pathways.J Cell Mol Med. 2019 May;23(5):3386-3401. doi: 10.1111/jcmm.14235. Epub 2019 Feb 22.
18 Observations on 261 consecutive patients with inflammatory bowel disease seen in the Southwest United States.Dig Dis Sci. 1980 Mar;25(3):198-204. doi: 10.1007/BF01308139.
19 Immunologic Effects of Metformin and Pioglitazone Treatment on Metabolic Syndrome and Multiple Sclerosis.JAMA Neurol. 2016 May 1;73(5):520-8. doi: 10.1001/jamaneurol.2015.4807.
20 Association between anti-thymocyte globulin exposure and survival outcomes in adult unrelated haemopoietic cell transplantation: a multicentre, retrospective, pharmacodynamic cohort analysis.Lancet Haematol. 2017 Apr;4(4):e183-e191. doi: 10.1016/S2352-3026(17)30029-7. Epub 2017 Mar 16.
21 The challenge of molecular testing for clinical trials in advanced non-small cell lung cancer patients: Analysis of a prospective database.Lung Cancer. 2016 Dec;102:96-100. doi: 10.1016/j.lungcan.2016.11.003. Epub 2016 Nov 6.
22 MARCH1 regulates insulin sensitivity by controlling cell surface insulin receptor levels.Nat Commun. 2016 Aug 31;7:12639. doi: 10.1038/ncomms12639.
23 Appropriateness of clinical severity classification of new WHO childhood pneumonia guidance: a multi-hospital, retrospective, cohort study.Lancet Glob Health. 2018 Jan;6(1):e74-e83. doi: 10.1016/S2214-109X(17)30448-5.
24 The Role of Gut Microbiome in the Pathogenesis of Prostate Cancer: A Prospective, Pilot Study.Urology. 2018 Jan;111:122-128. doi: 10.1016/j.urology.2017.08.039. Epub 2017 Sep 6.
25 Interplay Among Psychopathologic Variables, Personal Resources, Context-Related Factors, and Real-life Functioning in Individuals With Schizophrenia: A Network Analysis.JAMA Psychiatry. 2018 Apr 1;75(4):396-404. doi: 10.1001/jamapsychiatry.2017.4607.
26 Referral patterns of stroke rehabilitation inpatients to a model system of outpatient services in Ontario, Canada: a 7-year retrospective analysis.BMC Health Serv Res. 2019 Jun 20;19(1):399. doi: 10.1186/s12913-019-4236-5.
27 Apixaban and Rivaroxaban in Patients With Acute Venous Thromboembolism.Mayo Clin Proc. 2019 Jul;94(7):1242-1252. doi: 10.1016/j.mayocp.2018.09.022. Epub 2019 Feb 6.
28 ciRs-6 upregulates March1 to suppress bladder cancer growth by sponging miR-653.Aging (Albany NY). 2019 Dec 10;11(23):11202-11223. doi: 10.18632/aging.102525. Epub 2019 Dec 10.
29 Effectiveness of Colorectal Cancer Screening in Detecting Earlier-Stage Disease-A Nationwide Cohort Study in Denmark.Gastroenterology. 2018 Jul;155(1):99-106. doi: 10.1053/j.gastro.2018.03.062. Epub 2018 Apr 5.
30 Meta-analysis: diagnostic accuracy of antibody against peptidylarginine deiminase 4 by ELISA for rheumatoid arthritis.Clin Rheumatol. 2017 Nov;36(11):2431-2438. doi: 10.1007/s10067-017-3809-0. Epub 2017 Sep 8.
31 Association Between Allergen Exposure in Inner-City Schools and Asthma Morbidity Among Students.JAMA Pediatr. 2017 Jan 1;171(1):31-38. doi: 10.1001/jamapediatrics.2016.2543.
32 The prognostic value of PCNA expression in patients with osteosarcoma: A meta-analysis of 16 studies.Medicine (Baltimore). 2017 Oct;96(41):e8254. doi: 10.1097/MD.0000000000008254.
33 Estimated impact of hepatitis C-positive lung donor utilization on US donor lung supply.Am J Transplant. 2020 Jan;20(1):289-297. doi: 10.1111/ajt.15558. Epub 2019 Sep 5.
34 Responses to Topical Diphenylcyclopropenone as an Adjunct Treatment for In-Transit Melanoma: A Tertiary Referral Center Experience.Dermatol Surg. 2018 Dec;44(12):1501-1508. doi: 10.1097/DSS.0000000000001603.
35 Risk of cardiovascular events associated with dipeptidyl peptidase-4 inhibitors in patients with diabetes with and without chronic kidney disease: A nationwide cohort study.PLoS One. 2019 May 21;14(5):e0215248. doi: 10.1371/journal.pone.0215248. eCollection 2019.
36 IGH translocations in chronic lymphocytic leukemia: Clinicopathologic features and clinical outcomes.Am J Hematol. 2019 Mar;94(3):338-345. doi: 10.1002/ajh.25385. Epub 2019 Jan 8.
37 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
38 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
39 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
40 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
41 Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
42 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
43 Lymphocyte gene expression in subjects fed a low-choline diet differs between those who develop organ dysfunction and those who do not. Am J Clin Nutr. 2007 Jul;86(1):230-9. doi: 10.1093/ajcn/86.1.230.