Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLFZUQK)

DOT Name	ATP synthase subunit beta, mitochondrial (ATP5F1B)
Synonyms	EC 7.1.2.2; ATP synthase F1 subunit beta
Gene Name	ATP5F1B
Related Disease	Spinocerebellar ataxia type 17 ( ) Acute kidney injury ( ) Acute myocardial infarction ( ) Adenocarcinoma ( ) Adenoma ( ) Advanced cancer ( ) Alzheimer disease ( ) Cardiomyopathy ( ) Colorectal carcinoma ( ) Diabetic kidney disease ( ) Gallbladder cancer ( ) Gallbladder carcinoma ( ) High blood pressure ( ) Idiopathic cardiomyopathy ( ) Non-alcoholic fatty liver disease ( ) Non-alcoholic steatohepatitis ( ) Non-insulin dependent diabetes ( ) Obesity ( ) Parkinson disease ( ) Prostate cancer ( ) Prostate carcinoma ( ) Renal fibrosis ( ) Meningioma ( ) Adult glioblastoma ( ) Asthma ( ) Fetal growth restriction ( ) Glioblastoma multiforme ( ) Hypermetabolism due to uncoupled mitochondrial oxidative phosphorylation 2 ( ) Neoplasm ( ) Polycystic ovarian syndrome ( ) Precancerous condition ( )
UniProt ID	ATPB_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	8H9E; 8H9I; 8H9L; 8H9P; 8H9S; 8H9T; 8H9U; 8H9V
EC Number	7.1.2.2
Pfam ID	PF00006 ; PF02874
Sequence	MLGFVGRVAAAPASGALRRLTPSASLPPAQLLLRAAPTAVHPVRDYAAQTSPSPKAGAAT GRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLV RGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQ EILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERT REGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQD VLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAI YVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDV ARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGK LVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHSS
Function	Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Subunits alpha and beta form the catalytic core in F(1). Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits.
KEGG Pathway	Oxidative phosphorylation (hsa00190 ) Metabolic pathways (hsa01100 ) Thermogenesis (hsa04714 ) Alzheimer disease (hsa05010 ) Parkinson disease (hsa05012 ) Amyotrophic lateral sclerosis (hsa05014 ) Huntington disease (hsa05016 ) Prion disease (hsa05020 ) Pathways of neurodegeneration - multiple diseases (hsa05022 ) Chemical carcinogenesis - reactive oxygen species (hsa05208 ) Diabetic cardiomyopathy (hsa05415 )
Reactome Pathway	Formation of ATP by chemiosmotic coupling (R-HSA-163210 ) Transcriptional activation of mitochondrial biogenesis (R-HSA-2151201 ) Cristae formation (R-HSA-8949613 ) Mitochondrial protein import (R-HSA-1268020 )
BioCyc Pathway	MetaCyc:HS03358-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

31 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Spinocerebellar ataxia type 17	DISJXO7P	Definitive	Biomarker	[1]
Acute kidney injury	DISXZG0T	Strong	Biomarker	[2]
Acute myocardial infarction	DISE3HTG	Strong	Biomarker	[3]
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[4]
Adenoma	DIS78ZEV	Strong	Altered Expression	[4]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[5]
Alzheimer disease	DISF8S70	Strong	Altered Expression	[6]
Cardiomyopathy	DISUPZRG	Strong	Therapeutic	[7]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[8]
Diabetic kidney disease	DISJMWEY	Strong	Biomarker	[9]
Gallbladder cancer	DISXJUAF	Strong	Biomarker	[4]
Gallbladder carcinoma	DISD6ACL	Strong	Biomarker	[4]
High blood pressure	DISY2OHH	Strong	Biomarker	[10]
Idiopathic cardiomyopathy	DISUGBZL	Strong	Therapeutic	[7]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Biomarker	[2]
Non-alcoholic steatohepatitis	DIST4788	Strong	Biomarker	[2]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[11]
Obesity	DIS47Y1K	Strong	Altered Expression	[12]
Parkinson disease	DISQVHKL	Strong	Biomarker	[13]
Prostate cancer	DISF190Y	Strong	Biomarker	[14]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[14]
Renal fibrosis	DISMHI3I	Strong	Biomarker	[9]
Meningioma	DISPT4TG	moderate	Altered Expression	[15]
Adult glioblastoma	DISVP4LU	Limited	Altered Expression	[16]
Asthma	DISW9QNS	Limited	Altered Expression	[17]
Fetal growth restriction	DIS5WEJ5	Limited	Biomarker	[18]
Glioblastoma multiforme	DISK8246	Limited	Altered Expression	[16]
Hypermetabolism due to uncoupled mitochondrial oxidative phosphorylation 2	DIS3DKTL	Limited	Autosomal dominant	[19]
Neoplasm	DISZKGEW	Limited	Biomarker	[5]
Polycystic ovarian syndrome	DISZ2BNG	Limited	Biomarker	[20]
Precancerous condition	DISV06FL	Limited	Biomarker	[21]
------------------------------------------------------------------------------------


⏷ Show the Full List of 31 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 3 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Josamycin	DMKJ8LB	Approved	ATP synthase subunit beta, mitochondrial (ATP5F1B) affects the response to substance of Josamycin.	[46]
PEITC	DMOMN31	Phase 2	ATP synthase subunit beta, mitochondrial (ATP5F1B) affects the binding of PEITC.	[47]
Sulforaphane	DMQY3L0	Investigative	ATP synthase subunit beta, mitochondrial (ATP5F1B) affects the binding of Sulforaphane.	[47]
------------------------------------------------------------------------------------

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of ATP synthase subunit beta, mitochondrial (ATP5F1B).	[22]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of ATP synthase subunit beta, mitochondrial (ATP5F1B).	[39]
------------------------------------------------------------------------------------

25 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of ATP synthase subunit beta, mitochondrial (ATP5F1B).	[23]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of ATP synthase subunit beta, mitochondrial (ATP5F1B).	[24]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of ATP synthase subunit beta, mitochondrial (ATP5F1B).	[25]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of ATP synthase subunit beta, mitochondrial (ATP5F1B).	[26]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of ATP synthase subunit beta, mitochondrial (ATP5F1B).	[27]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of ATP synthase subunit beta, mitochondrial (ATP5F1B).	[28]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of ATP synthase subunit beta, mitochondrial (ATP5F1B).	[29]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of ATP synthase subunit beta, mitochondrial (ATP5F1B).	[31]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the expression of ATP synthase subunit beta, mitochondrial (ATP5F1B).	[27]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of ATP synthase subunit beta, mitochondrial (ATP5F1B).	[32]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the expression of ATP synthase subunit beta, mitochondrial (ATP5F1B).	[32]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of ATP synthase subunit beta, mitochondrial (ATP5F1B).	[33]
Cocaine	DMSOX7I	Approved	Cocaine decreases the expression of ATP synthase subunit beta, mitochondrial (ATP5F1B).	[34]
Pioglitazone	DMKJ485	Approved	Pioglitazone decreases the expression of ATP synthase subunit beta, mitochondrial (ATP5F1B).	[32]
Etretinate	DM2CZFA	Approved	Etretinate decreases the expression of ATP synthase subunit beta, mitochondrial (ATP5F1B).	[35]
Vitamin B3	DMQVRZH	Approved	Vitamin B3 decreases the expression of ATP synthase subunit beta, mitochondrial (ATP5F1B).	[36]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of ATP synthase subunit beta, mitochondrial (ATP5F1B).	[37]
Tanespimycin	DMNLQHK	Phase 2	Tanespimycin decreases the expression of ATP synthase subunit beta, mitochondrial (ATP5F1B).	[38]
NVP-AUY922	DMTYXQF	Phase 2	NVP-AUY922 decreases the expression of ATP synthase subunit beta, mitochondrial (ATP5F1B).	[38]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of ATP synthase subunit beta, mitochondrial (ATP5F1B).	[40]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of ATP synthase subunit beta, mitochondrial (ATP5F1B).	[41]
chloropicrin	DMSGBQA	Investigative	chloropicrin affects the expression of ATP synthase subunit beta, mitochondrial (ATP5F1B).	[42]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the expression of ATP synthase subunit beta, mitochondrial (ATP5F1B).	[43]
AHPN	DM8G6O4	Investigative	AHPN decreases the expression of ATP synthase subunit beta, mitochondrial (ATP5F1B).	[44]
Paraoxon	DMN4ZKC	Investigative	Paraoxon increases the expression of ATP synthase subunit beta, mitochondrial (ATP5F1B).	[45]
------------------------------------------------------------------------------------


⏷ Show the Full List of 25 Drug(s)

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Quercetin	DM3NC4M	Approved	Quercetin affects the binding of ATP synthase subunit beta, mitochondrial (ATP5F1B).	[30]
------------------------------------------------------------------------------------

References

1	Downregulation of proteins involved in the endoplasmic reticulum stress response and Nrf2-ARE signaling in lymphoblastoid cells of spinocerebellar ataxia type 17. J Neural Transm (Vienna). 2014 Jun;121(6):601-10.
2	Urinary ATP Synthase Subunit Is a Novel Biomarker of Renal Mitochondrial Dysfunction in Acute Kidney Injury.Toxicol Sci. 2015 May;145(1):108-17. doi: 10.1093/toxsci/kfv038. Epub 2015 Feb 9.
3	Isobaric tags for relative and absolute quantitationbased proteomics reveals potential novel biomarkers for the early diagnosis of acute myocardial infarction within 3h.Int J Mol Med. 2019 May;43(5):1991-2004. doi: 10.3892/ijmm.2019.4137. Epub 2019 Mar 19.
4	ATP5b and 2-microglobulin are predictive markers for the prognosis of patients with gallbladder cancer.J Mol Histol. 2015 Feb;46(1):57-65. doi: 10.1007/s10735-014-9597-9. Epub 2014 Oct 14.
5	A novel RNA aptamer identifies plasma membrane ATP synthase beta subunit as an early marker and therapeutic target in aggressive cancer.Breast Cancer Res Treat. 2019 Jul;176(2):271-289. doi: 10.1007/s10549-019-05174-3. Epub 2019 Apr 20.
6	Amylin Treatment Reduces Neuroinflammation and Ameliorates Abnormal Patterns of Gene Expression inthe Cerebral Cortex of an Alzheimer's Disease Mouse Model.J Alzheimers Dis. 2017;56(1):47-61. doi: 10.3233/JAD-160677.
7	[Screening of differentially expressed genes in rats with cardiomyopathy after bone marrow mesenchymal stem cell transplantation].Zhonghua Er Ke Za Zhi. 2006 Oct;44(10):787-91.
8	Investigation of the association between ATP2B4 and ATP5B genes with colorectal cancer.Gene. 2014 May 1;540(2):178-82. doi: 10.1016/j.gene.2014.02.050. Epub 2014 Feb 26.
9	ATP synthase subunit- down-regulation aggravates diabetic nephropathy.Sci Rep. 2015 Oct 9;5:14561. doi: 10.1038/srep14561.
10	Intracellular signaling for vasoconstrictor coupling factor 6: novel function of beta-subunit of ATP synthase as receptor.Hypertension. 2005 Nov;46(5):1140-6. doi: 10.1161/01.HYP.0000186483.86750.85. Epub 2005 Oct 17.
11	Detection of differential proteomes associated with the development of type 2 diabetes in the Zucker rat model using the iTRAQ technique.J Proteome Res. 2011 Feb 4;10(2):564-77. doi: 10.1021/pr100759a. Epub 2010 Dec 20.
12	Mitochondrial ATP synthase -subunit production rate and ATP synthase specific activity are reduced in skeletal muscle of humans with obesity.Exp Physiol. 2019 Jan;104(1):126-135. doi: 10.1113/EP087278. Epub 2018 Nov 12.
13	LRRK2 mutations impair depolarization-induced mitophagy through inhibition of mitochondrial accumulation of RAB10.Autophagy. 2020 Feb;16(2):203-222. doi: 10.1080/15548627.2019.1603548. Epub 2019 Apr 19.
14	Ectopic expression of the ATP synthase subunit on the membrane of PC-3M cells supports its potential role in prostate cancer metastasis.Int J Oncol. 2017 Apr;50(4):1312-1320. doi: 10.3892/ijo.2017.3878. Epub 2017 Feb 16.
15	Validation of Reference Genes for Expression Studies in Human Meningiomas under Different Experimental Settings.Mol Neurobiol. 2018 Jul;55(7):5787-5797. doi: 10.1007/s12035-017-0800-3. Epub 2017 Oct 27.
16	ATP5A1 and ATP5B are highly expressed in glioblastoma tumor cells and endothelial cells of microvascular proliferation.J Neurooncol. 2016 Feb;126(3):405-13. doi: 10.1007/s11060-015-1984-x. Epub 2015 Nov 2.
17	Overexpression of ATP5b promotes cell proliferation in asthma.Mol Med Rep. 2017 Nov;16(5):6946-6952. doi: 10.3892/mmr.2017.7413. Epub 2017 Aug 31.
18	Proteomic Analysis of One-carbon Metabolism-related Marker in Liver of Rat Offspring.Mol Cell Proteomics. 2015 Nov;14(11):2901-9. doi: 10.1074/mcp.M114.046888. Epub 2015 Sep 4.
19	Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
20	ATP synthase -subunit abnormality in pancreas islets of rats with polycystic ovary syndrome and type 2 diabetes mellitus.J Huazhong Univ Sci Technolog Med Sci. 2017 Apr;37(2):210-216. doi: 10.1007/s11596-017-1717-9. Epub 2017 Apr 11.
21	Hepatocellular carcinoma-associated protein markers investigated by MALDI-TOF MS.Mol Med Rep. 2010 Jul-Aug;3(4):589-96. doi: 10.3892/mmr_00000302.
22	Integrated 'omics analysis reveals new drug-induced mitochondrial perturbations in human hepatocytes. Toxicol Lett. 2018 Jun 1;289:1-13.
23	Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
24	Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
25	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
26	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
27	Regulation of ERRalpha gene expression by estrogen receptor agonists and antagonists in SKBR3 breast cancer cells: differential molecular mechanisms mediated by g protein-coupled receptor GPR30/GPER-1. Mol Endocrinol. 2010 May;24(5):969-80. doi: 10.1210/me.2009-0148. Epub 2010 Mar 8.
28	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
29	Aberrant cell proliferation by enhanced mitochondrial biogenesis via mtTFA in arsenical skin cancers. Am J Pathol. 2011 May;178(5):2066-76.
30	Biotinylated quercetin as an intrinsic photoaffinity proteomics probe for the identification of quercetin target proteins. Bioorg Med Chem. 2011 Aug 15;19(16):4710-20. doi: 10.1016/j.bmc.2011.07.005. Epub 2011 Jul 13.
31	Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
32	Troglitazone induces cytotoxicity in part by promoting the degradation of peroxisome proliferator-activated receptor co-activator-1 protein. Br J Pharmacol. 2010 Oct;161(4):771-81. doi: 10.1111/j.1476-5381.2010.00900.x.
33	Effects of acute ethanol treatment on NCCIT cells and NCCIT cell-derived embryoid bodies (EBs). Toxicol In Vitro. 2010 Sep;24(6):1696-704. doi: 10.1016/j.tiv.2010.05.017. Epub 2010 May 26.
34	Cytosolic proteomic alterations in the nucleus accumbens of cocaine overdose victims. Mol Psychiatry. 2007 Jan;12(1):55-73. doi: 10.1038/sj.mp.4001914. Epub 2006 Oct 31.
35	Consequences of the natural retinoid/retinoid X receptor ligands action in human breast cancer MDA-MB-231 cell line: Focus on functional proteomics. Toxicol Lett. 2017 Nov 5;281:26-34. doi: 10.1016/j.toxlet.2017.09.001. Epub 2017 Sep 5.
36	Niacin inhibits surface expression of ATP synthase beta chain in HepG2 cells: implications for raising HDL. J Lipid Res. 2008 Jun;49(6):1195-201. doi: 10.1194/jlr.M700426-JLR200. Epub 2008 Mar 3.
37	Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
38	Impact of Heat Shock Protein 90 Inhibition on the Proteomic Profile of Lung Adenocarcinoma as Measured by Two-Dimensional Electrophoresis Coupled with Mass Spectrometry. Cells. 2019 Jul 31;8(8):806. doi: 10.3390/cells8080806.
39	Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
40	Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
41	Synergistic effect of trichostatin A and 5-aza-2'-deoxycytidine on growth inhibition of pancreatic endocrine tumour cell lines: a proteomic study. Proteomics. 2009 Apr;9(7):1952-66. doi: 10.1002/pmic.200701089.
42	Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
43	In vitro gene expression data supporting a DNA non-reactive genotoxic mechanism for ochratoxin A. Toxicol Appl Pharmacol. 2007 Apr 15;220(2):216-24.
44	ST1926, a novel and orally active retinoid-related molecule inducing apoptosis in myeloid leukemia cells: modulation of intracellular calcium homeostasis. Blood. 2004 Jan 1;103(1):194-207.
45	Paraoxon-induced protein expression changes to SH-SY5Y cells. Chem Res Toxicol. 2010 Nov 15;23(11):1656-62. doi: 10.1021/tx100192f. Epub 2010 Oct 8.
46	A genome-wide analysis of targets of macrolide antibiotics in mammalian cells. J Biol Chem. 2020 Feb 14;295(7):2057-2067. doi: 10.1074/jbc.RA119.010770. Epub 2020 Jan 8.
47	Identification of potential protein targets of isothiocyanates by proteomics. Chem Res Toxicol. 2011 Oct 17;24(10):1735-43. doi: 10.1021/tx2002806. Epub 2011 Aug 26.