Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLP0A0Y)

DOT Name	Glutathione S-transferase P (GSTP1)
Synonyms	EC 2.5.1.18; GST class-pi; GSTP1-1
Gene Name	GSTP1
UniProt ID	GSTP1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	10GS ; 11GS ; 12GS ; 13GS ; 14GS ; 16GS ; 17GS ; 18GS ; 19GS ; 1AQV ; 1AQW ; 1AQX ; 1EOG ; 1EOH ; 1GSS ; 1KBN ; 1LBK ; 1MD3 ; 1MD4 ; 1PGT ; 1PX6 ; 1PX7 ; 1ZGN ; 20GS ; 22GS ; 2A2R ; 2A2S ; 2GSS ; 2J9H ; 2PGT ; 3CSH ; 3CSI ; 3CSJ ; 3DD3 ; 3DGQ ; 3GSS ; 3GUS ; 3HJM ; 3HJO ; 3HKR ; 3IE3 ; 3KM6 ; 3KMN ; 3KMO ; 3N9J ; 3PGT ; 4GSS ; 4PGT ; 5DAK ; 5DAL ; 5DCG ; 5DDL ; 5DJL ; 5DJM ; 5GSS ; 5J41 ; 5JCW ; 5L6X ; 5X79 ; 6AP9 ; 6GSS ; 6LLX ; 6Y1E ; 7BIA ; 7GSS ; 7XBA ; 8GSS ; 9GSS
EC Number	2.5.1.18
Pfam ID	PF14497 ; PF02798
Sequence	MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGD LTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYV KALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAY VGRLSARPKLKAFLASPEYVNLPINGNGKQ
Function	Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2). Participates in the formation of novel hepoxilin regioisomers. Negatively regulates CDK5 activity via p25/p35 translocation to prevent neurodegeneration.
KEGG Pathway	Glutathione metabolism (hsa00480 ) Metabolism of xenobiotics by cytochrome P450 (hsa00980 ) Drug metabolism - cytochrome P450 (hsa00982 ) Drug metabolism - other enzymes (hsa00983 ) Metabolic pathways (hsa01100 ) Platinum drug resistance (hsa01524 ) Pathways in cancer (hsa05200 ) Chemical carcinogenesis - D. adducts (hsa05204 ) Prostate cancer (hsa05215 ) Hepatocellular carcinoma (hsa05225 ) Fluid shear stress and atherosclerosis (hsa05418 )
Reactome Pathway	Detoxification of Reactive Oxygen Species (R-HSA-3299685 ) Neutrophil degranulation (R-HSA-6798695 ) Paracetamol ADME (R-HSA-9753281 ) Glutathione conjugation (R-HSA-156590 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 18 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Glutathione S-transferase P (GSTP1) decreases the response to substance of Acetaminophen.	[65]
Hydroquinone	DM6AVR4	Approved	Glutathione S-transferase P (GSTP1) affects the response to substance of Hydroquinone.	[67]
Etoposide	DMNH3PG	Approved	Glutathione S-transferase P (GSTP1) decreases the response to substance of Etoposide.	[68]
Paclitaxel	DMLB81S	Approved	Glutathione S-transferase P (GSTP1) increases the response to substance of Paclitaxel.	[69]
DTI-015	DMXZRW0	Approved	Glutathione S-transferase P (GSTP1) decreases the response to substance of DTI-015.	[70]
Mitomycin	DMH0ZJE	Approved	Glutathione S-transferase P (GSTP1) increases the response to substance of Mitomycin.	[69]
Cocaine	DMSOX7I	Approved	Glutathione S-transferase P (GSTP1) affects the response to substance of Cocaine.	[71]
Ifosfamide	DMCT3I8	Approved	Glutathione S-transferase P (GSTP1) increases the response to substance of Ifosfamide.	[72]
Methamphetamine	DMPM4SK	Approved	Glutathione S-transferase P (GSTP1) increases the response to substance of Methamphetamine.	[73]
Docetaxel	DMDI269	Approved	Glutathione S-transferase P (GSTP1) increases the response to substance of Docetaxel.	[69]
Nitric Oxide	DM1RBYG	Approved	Glutathione S-transferase P (GSTP1) affects the response to substance of Nitric Oxide.	[74]
Deoxycholic acid	DM3GYAL	Approved	Glutathione S-transferase P (GSTP1) increases the response to substance of Deoxycholic acid.	[75]
Chlorambucil	DMRKE63	Approved	Glutathione S-transferase P (GSTP1) decreases the response to substance of Chlorambucil.	[68]
Epanova	DMHEAGL	Approved	Glutathione S-transferase P (GSTP1) affects the response to substance of Epanova.	[78]
Thiotepa	DMIZKOP	Approved	Glutathione S-transferase P (GSTP1) decreases the response to substance of Thiotepa.	[80]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	Glutathione S-transferase P (GSTP1) decreases the response to substance of 4-hydroxy-2-nonenal.	[81]
Manganese	DMKT129	Investigative	Glutathione S-transferase P (GSTP1) affects the response to substance of Manganese.	[82]
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE	DMNQL17	Investigative	Glutathione S-transferase P (GSTP1) affects the response to substance of 2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE.	[83]
------------------------------------------------------------------------------------


⏷ Show the Full List of 18 Drug(s)

This DOT Affected the Regulation of Drug Effects of 6 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Isotretinoin	DM4QTBN	Approved	Glutathione S-transferase P (GSTP1) affects the metabolism of Isotretinoin.	[66]
Busulfan	DMXYJ9C	Approved	Glutathione S-transferase P (GSTP1) affects the abundance of Busulfan.	[77]
crotylaldehyde	DMTWRQI	Investigative	Glutathione S-transferase P (GSTP1) increases the metabolism of crotylaldehyde.	[84]
acrolein	DMAMCSR	Investigative	Glutathione S-transferase P (GSTP1) increases the metabolism of acrolein.	[84]
Aminohippuric acid	DMUN54G	Investigative	Glutathione S-transferase P (GSTP1) increases the metabolism of Aminohippuric acid.	[85]
TEPA (possesses cytotoxic activity)	DMROS5K	Investigative	Glutathione S-transferase P (GSTP1) affects the export of TEPA (possesses cytotoxic activity).	[87]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Drug(s)

This DOT Affected the Biotransformations of 3 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Nevirapine	DM6HX9B	Approved	Glutathione S-transferase P (GSTP1) increases the glutathionylation of Nevirapine.	[76]
Mefenamic acid	DMK7HFI	Approved	Glutathione S-transferase P (GSTP1) increases the glutathionylation of Mefenamic acid.	[79]
NAPQI	DM8F5LR	Investigative	Glutathione S-transferase P (GSTP1) increases the glutathionylation of NAPQI.	[86]
------------------------------------------------------------------------------------

75 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Glutathione S-transferase P (GSTP1).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Glutathione S-transferase P (GSTP1).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Glutathione S-transferase P (GSTP1).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Glutathione S-transferase P (GSTP1).	[4]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Glutathione S-transferase P (GSTP1).	[5]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Glutathione S-transferase P (GSTP1).	[6]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of Glutathione S-transferase P (GSTP1).	[7]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Glutathione S-transferase P (GSTP1).	[8]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Glutathione S-transferase P (GSTP1).	[9]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Glutathione S-transferase P (GSTP1).	[10]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Glutathione S-transferase P (GSTP1).	[11]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Glutathione S-transferase P (GSTP1).	[12]
Selenium	DM25CGV	Approved	Selenium increases the expression of Glutathione S-transferase P (GSTP1).	[14]
Phenobarbital	DMXZOCG	Approved	Phenobarbital decreases the expression of Glutathione S-transferase P (GSTP1).	[15]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Glutathione S-transferase P (GSTP1).	[16]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Glutathione S-transferase P (GSTP1).	[17]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the activity of Glutathione S-transferase P (GSTP1).	[18]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the activity of Glutathione S-transferase P (GSTP1).	[19]
Clozapine	DMFC71L	Approved	Clozapine decreases the activity of Glutathione S-transferase P (GSTP1).	[18]
Malathion	DMXZ84M	Approved	Malathion decreases the expression of Glutathione S-transferase P (GSTP1).	[20]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid decreases the expression of Glutathione S-transferase P (GSTP1).	[21]
Rifampicin	DM5DSFZ	Approved	Rifampicin increases the expression of Glutathione S-transferase P (GSTP1).	[22]
Acetic Acid, Glacial	DM4SJ5Y	Approved	Acetic Acid, Glacial increases the expression of Glutathione S-transferase P (GSTP1).	[23]
Haloperidol	DM96SE0	Approved	Haloperidol decreases the expression of Glutathione S-transferase P (GSTP1).	[24]
Dopamine	DMPGUCF	Approved	Dopamine decreases the activity of Glutathione S-transferase P (GSTP1).	[25]
Etretinate	DM2CZFA	Approved	Etretinate increases the expression of Glutathione S-transferase P (GSTP1).	[26]
Artesunate	DMR27C8	Approved	Artesunate decreases the expression of Glutathione S-transferase P (GSTP1).	[27]
Glutathione	DMAHMT9	Approved	Glutathione decreases the activity of Glutathione S-transferase P (GSTP1).	[28]
Tetracycline	DMZA017	Approved	Tetracycline decreases the activity of Glutathione S-transferase P (GSTP1).	[29]
Cimetidine	DMH61ZB	Approved	Cimetidine affects the expression of Glutathione S-transferase P (GSTP1).	[22]
Imipramine	DM2NUH3	Approved	Imipramine decreases the activity of Glutathione S-transferase P (GSTP1).	[30]
Clomipramine	DMINRKW	Approved	Clomipramine decreases the activity of Glutathione S-transferase P (GSTP1).	[30]
Ethacrynic acid	DM60QMR	Approved	Ethacrynic acid decreases the activity of Glutathione S-transferase P (GSTP1).	[31]
Quinidine	DMLPICK	Approved	Quinidine decreases the activity of Glutathione S-transferase P (GSTP1).	[29]
Hydralazine	DMU8JGH	Approved	Hydralazine increases the expression of Glutathione S-transferase P (GSTP1).	[32]
Pyrimethamine	DM5X7VY	Approved	Pyrimethamine decreases the activity of Glutathione S-transferase P (GSTP1).	[29]
Doxepin	DMPI98T	Approved	Doxepin decreases the activity of Glutathione S-transferase P (GSTP1).	[30]
Quinine	DMSWYF5	Approved	Quinine decreases the activity of Glutathione S-transferase P (GSTP1).	[29]
Aclarubicin	DMLFZHD	Approved	Aclarubicin increases the expression of Glutathione S-transferase P (GSTP1).	[3]
Artemisinin	DMOY7W3	Approved	Artemisinin decreases the activity of Glutathione S-transferase P (GSTP1).	[29]
Methyldopa	DM5I621	Approved	Methyldopa decreases the activity of Glutathione S-transferase P (GSTP1).	[25]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Glutathione S-transferase P (GSTP1).	[33]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of Glutathione S-transferase P (GSTP1).	[34]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Glutathione S-transferase P (GSTP1).	[35]
Camptothecin	DM6CHNJ	Phase 3	Camptothecin increases the expression of Glutathione S-transferase P (GSTP1).	[36]
Bardoxolone methyl	DMODA2X	Phase 3	Bardoxolone methyl increases the expression of Glutathione S-transferase P (GSTP1).	[37]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Glutathione S-transferase P (GSTP1).	[14]
DNCB	DMDTVYC	Phase 2	DNCB increases the activity of Glutathione S-transferase P (GSTP1).	[38]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate decreases the expression of Glutathione S-transferase P (GSTP1).	[3]
PEITC	DMOMN31	Phase 2	PEITC increases the expression of Glutathione S-transferase P (GSTP1).	[39]
ME-344	DM6JN19	Phase 1/2	ME-344 increases the expression of Glutathione S-transferase P (GSTP1).	[40]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Glutathione S-transferase P (GSTP1).	[41]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Glutathione S-transferase P (GSTP1).	[42]
Eugenol	DM7US1H	Patented	Eugenol decreases the activity of Glutathione S-transferase P (GSTP1).	[43]
PMID26394986-Compound-22	DM43Z1G	Patented	PMID26394986-Compound-22 increases the expression of Glutathione S-transferase P (GSTP1).	[44]
MG-132	DMKA2YS	Preclinical	MG-132 increases the expression of Glutathione S-transferase P (GSTP1).	[45]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Glutathione S-transferase P (GSTP1).	[47]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Glutathione S-transferase P (GSTP1).	[48]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the activity of Glutathione S-transferase P (GSTP1).	[49]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Glutathione S-transferase P (GSTP1).	[50]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Glutathione S-transferase P (GSTP1).	[51]
QUERCITRIN	DM1DH96	Investigative	QUERCITRIN decreases the expression of Glutathione S-transferase P (GSTP1).	[52]
Butanoic acid	DMTAJP7	Investigative	Butanoic acid decreases the expression of Glutathione S-transferase P (GSTP1).	[53]
Okadaic acid	DM47CO1	Investigative	Okadaic acid increases the expression of Glutathione S-transferase P (GSTP1).	[54]
Bilirubin	DMI0V4O	Investigative	Bilirubin decreases the expression of Glutathione S-transferase P (GSTP1).	[55]
Rutin	DMEHRAJ	Investigative	Rutin decreases the expression of Glutathione S-transferase P (GSTP1).	[56]
Kaempferol	DMHEMUB	Investigative	Kaempferol decreases the activity of Glutathione S-transferase P (GSTP1).	[57]
2-tert-butylbenzene-1,4-diol	DMNXI1E	Investigative	2-tert-butylbenzene-1,4-diol increases the expression of Glutathione S-transferase P (GSTP1).	[58]
PD98059	DMZC90M	Investigative	PD98059 decreases the expression of Glutathione S-transferase P (GSTP1).	[59]
Galangin	DM5TQ2O	Investigative	Galangin decreases the activity of Glutathione S-transferase P (GSTP1).	[57]
Alpha-naphthoflavone	DMELOIQ	Investigative	Alpha-naphthoflavone decreases the expression of Glutathione S-transferase P (GSTP1).	[60]
Icosapentum	DMF1CM7	Investigative	Icosapentum decreases the expression of Glutathione S-transferase P (GSTP1).	[61]
Plumbagin	DM9BS50	Investigative	Plumbagin increases the expression of Glutathione S-transferase P (GSTP1).	[62]
ERIODICTYOL	DMD3BEQ	Investigative	ERIODICTYOL decreases the activity of Glutathione S-transferase P (GSTP1).	[57]
Chloroben	DMY40UB	Investigative	Chloroben decreases the activity of Glutathione S-transferase P (GSTP1).	[64]
------------------------------------------------------------------------------------


⏷ Show the Full List of 75 Drug(s)

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Decitabine	DMQL8XJ	Approved	Decitabine decreases the methylation of Glutathione S-transferase P (GSTP1).	[13]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Glutathione S-transferase P (GSTP1).	[46]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
M-Phenoxybenzoic Acid For Cis-Isomer	DMJRK47	Investigative	M-Phenoxybenzoic Acid For Cis-Isomer affects the binding of Glutathione S-transferase P (GSTP1).	[63]
------------------------------------------------------------------------------------

References

1	Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2	Benzodithiophenes potentiate differentiation of acute promyelocytic leukemia cells by lowering the threshold for ligand-mediated corepressor/coactivator exchange with retinoic acid receptor alpha and enhancing changes in all-trans-retinoic acid-regulated gene expression. Cancer Res. 2005 Sep 1;65(17):7856-65. doi: 10.1158/0008-5472.CAN-05-1056.
3	Expression of glutathione S-transferase P1-1 in differentiating K562: role of GATA-1. Biochem Biophys Res Commun. 2003 Nov 28;311(4):815-21.
4	Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
5	Human drug metabolism genes in parathion-and estrogen-treated breast cells. Int J Mol Med. 2007 Dec;20(6):875-81.
6	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
7	Effect of arsenic exposure on NRF2-KEAP1 pathway and epigenetic modification. Biol Trace Elem Res. 2018 Sep;185(1):11-19.
8	Single and concerted effects of benzo[a]pyrene and flavonoids on the AhR and Nrf2-pathway in the human colon carcinoma cell line Caco-2. Toxicol In Vitro. 2011 Apr;25(3):671-83.
9	Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
10	Arsenic trioxide inhibits DNA methyltransferase and restores methylation-silenced genes in human liver cancer cells. Hum Pathol. 2006 Mar;37(3):298-311.
11	Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
12	Proteomic analysis of liver cancer cells treated with suberonylanilide hydroxamic acid. Cancer Chemother Pharmacol. 2008 Apr;61(5):791-802.
13	The effect of dietary polyphenols on the epigenetic regulation of gene expression in MCF7 breast cancer cells. Toxicol Lett. 2010 Feb 1;192(2):119-25.
14	Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
15	Xenobiotic CAR activators induce Dlk1-Dio3 locus noncoding RNA expression in mouse liver. Toxicol Sci. 2017 Aug 1;158(2):367-378.
16	Cell-type-specific responses to chemotherapeutics in breast cancer. Cancer Res. 2004 Jun 15;64(12):4218-26.
17	Cannabidiol induces antioxidant pathways in keratinocytes by targeting BACH1. Redox Biol. 2020 Jan;28:101321. doi: 10.1016/j.redox.2019.101321. Epub 2019 Sep 5.
18	Application of CYP102A1M11H as a tool for the generation of protein adducts of reactive drug metabolites. Chem Res Toxicol. 2011 Aug 15;24(8):1263-74.
19	Simulation of interindividual differences in inactivation of reactive para-benzoquinone imine metabolites of diclofenac by glutathione S-transferases in human liver cytosol. Toxicol Lett. 2016 Jul 25;255:52-62.
20	Malathion induced cancer-linked gene expression in human lymphocytes. Environ Res. 2020 Mar;182:109131. doi: 10.1016/j.envres.2020.109131. Epub 2020 Jan 10.
21	Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
22	Expression and inducibility of cytochrome P450s (CYP1A1, 2B6, 2E1, 3A4) in human cord blood CD34(+) stem cell-derived differentiating neuronal cells. Toxicol Sci. 2012 Oct;129(2):392-410.
23	Glycidamide and cis-2-butene-1,4-dial (BDA) as potential carcinogens and promoters of liver cancer - An in vitro study. Food Chem Toxicol. 2022 Aug;166:113251. doi: 10.1016/j.fct.2022.113251. Epub 2022 Jun 21.
24	Reversal effect of haloperidol on doxorubicin resistance and chloride channel inhibition in erythroleukemic cell K562/Dox. Zhonghua Zhong Liu Za Zhi. 2005 Feb;27(2):81-5.
25	Inhibition of human glutathione S-transferases by dopamine, alpha-methyldopa and their 5-S-glutathionyl conjugates. Chem Biol Interact. 1994 Jan;90(1):87-99.
26	Consequences of the natural retinoid/retinoid X receptor ligands action in human breast cancer MDA-MB-231 cell line: Focus on functional proteomics. Toxicol Lett. 2017 Nov 5;281:26-34. doi: 10.1016/j.toxlet.2017.09.001. Epub 2017 Sep 5.
27	Combination treatment of malignant B cells using the anti-CD20 antibody rituximab and the anti-malarial artesunate. Int J Oncol. 2009 Jul;35(1):149-58.
28	Synthesis and activity of novel glutathione analogues containing an urethane backbone linkage. Farmaco. 2003 Sep;58(9):787-93.
29	Inhibition of glutathione S-transferases by antimalarial drugs possible implications for circumventing anticancer drug resistance. Int J Cancer. 2002 Feb 10;97(5):700-5.
30	Glutathione S-transferase pi as a target for tricyclic antidepressants in human brain. Acta Biochim Pol. 2004;51(1):207-12.
31	Synthesis and structure-activity relationship of ethacrynic acid analogues on glutathione-s-transferase P1-1 activity inhibition. Bioorg Med Chem. 2005 Jun 2;13(12):4056-62. doi: 10.1016/j.bmc.2005.03.046.
32	A phase I study of hydralazine to demethylate and reactivate the expression of tumor suppressor genes. BMC Cancer. 2005 Apr 29;5:44.
33	Interactive gene expression pattern in prostate cancer cells exposed to phenolic antioxidants. Life Sci. 2002 Mar 1;70(15):1821-39.
34	Impact of epigallocatechin gallate on gene expression profiles of human hepatocellular carcinoma cell lines BEL7404/ADM and BEL7402/5-FU. Ai Zheng. 2008 Oct;27(10):1056-64.
35	Induction of apoptosis by curcumin: mediation by glutathione S-transferase P1-1 inhibition. Biochem Pharmacol. 2003 Oct 15;66(8):1475-83.
36	GSTP1 affects chemoresistance against camptothecin in human lung adenocarcinoma cells. Cancer Lett. 2004 Dec 8;216(1):89-102.
37	Fluorescent tagging of endogenous Heme oxygenase-1 in human induced pluripotent stem cells for high content imaging of oxidative stress in various differentiated lineages. Arch Toxicol. 2021 Oct;95(10):3285-3302. doi: 10.1007/s00204-021-03127-8. Epub 2021 Sep 4.
38	The essential role of GSTP1 I105V polymorphism in the prediction of CDNB metabolism and toxicity: In silico and in vitro insights. Toxicol In Vitro. 2023 Aug;90:105601. doi: 10.1016/j.tiv.2023.105601. Epub 2023 Apr 7.
39	Combination of xanthohumol and phenethyl isothiocyanate inhibits NF-B and activates Nrf2 in pancreatic cancer cells. Toxicol In Vitro. 2020 Jun;65:104799. doi: 10.1016/j.tiv.2020.104799. Epub 2020 Feb 15.
40	Isoflavone ME-344 Disrupts Redox Homeostasis and Mitochondrial Function by Targeting Heme Oxygenase 1. Cancer Res. 2019 Aug 15;79(16):4072-4085. doi: 10.1158/0008-5472.CAN-18-3503. Epub 2019 Jun 21.
41	Air pollution particulate matter (PM2.5)-induced gene expression of volatile organic compound and/or polycyclic aromatic hydrocarbon-metabolizing enzymes in an in vitro coculture lung model. Toxicol In Vitro. 2009 Feb;23(1):37-46.
42	Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
43	Inhibition of rat, mouse, and human glutathione S-transferase by eugenol and its oxidation products. Chem Biol Interact. 1996 Jan 5;99(1-3):85-97.
44	The effects of cyclooxygenase-2 expression in prostate cancer cells: modulation of response to cytotoxic agents. J Pharmacol Exp Ther. 2008 Mar;324(3):1181-7.
45	Selective induction of the tumor marker glutathione S-transferase P1 by proteasome inhibitors. J Biol Chem. 2005 Jul 1;280(26):25267-76.
46	Oncogenic Potential of Bisphenol A and Common Environmental Contaminants in Human Mammary Epithelial Cells. Int J Mol Sci. 2020 May 25;21(10):3735. doi: 10.3390/ijms21103735.
47	Synergistic effect of trichostatin A and 5-aza-2'-deoxycytidine on growth inhibition of pancreatic endocrine tumour cell lines: a proteomic study. Proteomics. 2009 Apr;9(7):1952-66. doi: 10.1002/pmic.200701089.
48	Identification of formaldehyde-responsive genes by suppression subtractive hybridization. Toxicology. 2008 Jan 14;243(1-2):224-35.
49	Glutathione- and thioredoxin-related enzymes are modulated by sulfur-containing chemopreventive agents. Biol Chem. 2007 Oct;388(10):1069-81.
50	Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
51	Microphysiological system modeling of ochratoxin A-associated nephrotoxicity. Toxicology. 2020 Nov;444:152582. doi: 10.1016/j.tox.2020.152582. Epub 2020 Sep 6.
52	Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.
53	Butyrate interacts with benzo[a]pyrene to alter expression and activities of xenobiotic metabolizing enzymes involved in metabolism of carcinogens within colon epithelial cell models. Toxicology. 2019 Jan 15;412:1-11.
54	Whole genome mRNA transcriptomics analysis reveals different modes of action of the diarrheic shellfish poisons okadaic acid and dinophysis toxin-1 versus azaspiracid-1 in Caco-2 cells. Toxicol In Vitro. 2018 Feb;46:102-112.
55	Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.
56	Epicatechin and a cocoa polyphenolic extract modulate gene expression in human Caco-2 cells. J Nutr. 2004 Oct;134(10):2509-16.
57	Structural requirements for the flavonoid-mediated modulation of glutathione S-transferase P1-1 and GS-X pump activity in MCF7 breast cancer cells. Biochem Pharmacol. 2004 Apr 15;67(8):1607-17.
58	Expression of glutathione S-transferase P1-1 in leukemic cells is regulated by inducible AP-1 binding. Cancer Lett. 2004 Dec 28;216(2):207-19.
59	GSTP1 determines cis-platinum cytotoxicity in gastric adenocarcinoma MGC803 cells: regulation by promoter methylation and extracellular regulated kinase signaling. Anticancer Drugs. 2009 Mar;20(3):208-14.
60	A human intervention study with foods containing natural Ah-receptor agonists does not significantly show AhR-mediated effects as measured in blood cells and urine. Chem Biol Interact. 2008 Oct 22;176(1):19-29.
61	The influence of curcumin, quercetin, and eicosapentaenoic acid on the expression of phase II detoxification enzymes in the intestinal cell lines HT-29, Caco-2, HuTu 80, and LT97. Nutr Cancer. 2012 Aug;64(6):856-63.
62	Plumbagin, a novel Nrf2/ARE activator, protects against cerebral ischemia. J Neurochem. 2010 Mar;112(5):1316-26.
63	Structure-based Identification of Endocrine Disrupting Pesticides Targeting Breast Cancer Proteins. Toxicology. 2020 Jun;439:152459. doi: 10.1016/j.tox.2020.152459. Epub 2020 Apr 9.
64	Study on the interaction between the skin detoxifying enzyme glutathione S-transferase and the substances listed in the CE/39/2000 rules with the "skin" annotation, finalized to the biological monitoring of exposed subjects. G Ital Med Lav Ergon. 2007 Jul-Sep;29(3 Suppl):523-6.
65	Humanizing -class glutathione S-transferase regulation in a mouse model alters liver toxicity in response to acetaminophen overdose. PLoS One. 2011;6(10):e25707. doi: 10.1371/journal.pone.0025707. Epub 2011 Oct 11.
66	Recombinant human glutathione S-transferases catalyse enzymic isomerization of 13-cis-retinoic acid to all-trans-retinoic acid in vitro. Biochem J. 1998 Nov 15;336 ( Pt 1)(Pt 1):223-6. doi: 10.1042/bj3360223.
67	GSTM1, GSTT1, and GSTP1 polymorphism in north Indian population and its influence on the hydroquinone-induced in vitro genotoxicity. Toxicol Mech Methods. 2009 Jan;19(1):59-65. doi: 10.1080/15376510802399057.
68	The influence of coordinate overexpression of glutathione phase II detoxification gene products on drug resistance. J Pharmacol Exp Ther. 2000 Aug;294(2):480-7.
69	Concise prediction models of anticancer efficacy of 8 drugs using expression data from 12 selected genes. Int J Cancer. 2004 Sep 10;111(4):617-26. doi: 10.1002/ijc.20289.
70	In vitro drug response and molecular markers associated with drug resistance in malignant gliomas. Clin Cancer Res. 2006 Aug 1;12(15):4523-32. doi: 10.1158/1078-0432.CCR-05-1830.
71	A GSTP1 functional variant associated with cocaine dependence in a Brazilian population. Pharmacogenet Genomics. 2005 Dec;15(12):891-3. doi: 10.1097/01213011-200512000-00007.
72	Role of GSTM1, GSTP1, and GSTT1 gene polymorphism in ifosfamide metabolism affecting neurotoxicity and nephrotoxicity in children. J Pediatr Hematol Oncol. 2005 Nov;27(11):582-9. doi: 10.1097/01.mph.0000187429.52616.8a.
73	A functional glutathione S-transferase P1 gene polymorphism is associated with methamphetamine-induced psychosis in Japanese population. Am J Med Genet B Neuropsychiatr Genet. 2005 May 5;135B(1):5-9. doi: 10.1002/ajmg.b.30164.
74	Interactions between glutathione S-transferase P1, tumor necrosis factor, and traffic-related air pollution for development of childhood allergic disease. Environ Health Perspect. 2008 Aug;116(8):1077-84. doi: 10.1289/ehp.11117.
75	Glutathione-S-transferase P1-1 protects aberrant crypt foci from apoptosis induced by deoxycholic acid. Gastroenterology. 2004 Aug;127(2):428-43. doi: 10.1053/j.gastro.2004.05.021.
76	Different Reactive Metabolites of Nevirapine Require Distinct Glutathione S-Transferase Isoforms for Bioinactivation. Chem Res Toxicol. 2016 Dec 19;29(12):2136-2144. doi: 10.1021/acs.chemrestox.6b00250. Epub 2016 Nov 28.
77	Influence of glutathione S-transferase A1, P1, M1, T1 polymorphisms on oral busulfan pharmacokinetics in children with congenital hemoglobinopathies undergoing hematopoietic stem cell transplantation. Pediatr Blood Cancer. 2010 Dec 1;55(6):1172-9. doi: 10.1002/pbc.22739.
78	Marine n-3 fatty acid intake, glutathione S-transferase polymorphisms and breast cancer risk in post-menopausal Chinese women in Singapore. Carcinogenesis. 2004 Nov;25(11):2143-7. doi: 10.1093/carcin/bgh230. Epub 2004 Jul 15.
79	Cytochrome P450-mediated bioactivation of mefenamic acid to quinoneimine intermediates and inactivation by human glutathione S-transferases. Chem Res Toxicol. 2014 Dec 15;27(12):2071-81.
80	Differential catalytic efficiency of allelic variants of human glutathione S-transferase Pi in catalyzing the glutathione conjugation of thiotepa. Arch Biochem Biophys. 1999 Jun 1;366(1):89-94.
81	Genotoxicity of 4-hydroxy-2-nonenal in human colon tumor cells is associated with cellular levels of glutathione and the modulation of glutathione S-transferase A4 expression by butyrate. Toxicol Sci. 2005 Jul;86(1):27-35. doi: 10.1093/toxsci/kfi171. Epub 2005 Apr 13.
82	Interaction between manganese and GSTP1 in relation to autism spectrum disorder while controlling for exposure to mixture of lead, mercury, arsenic, and cadmium. Res Autism Spectr Disord. 2018 Nov;55:50-63. doi: 10.1016/j.rasd.2018.08.003. Epub 2018 Sep 5.
83	Xenobiotic metabolizing gene variants, dietary heterocyclic amine intake, and risk of prostate cancer. Cancer Res. 2009 Mar 1;69(5):1877-84. doi: 10.1158/0008-5472.CAN-08-2447. Epub 2009 Feb 17.
84	Catalytic efficiencies of allelic variants of human glutathione S-transferase Pi in the glutathione conjugation of alpha, beta-unsaturated aldehydes. Cancer Lett. 2000 Jun 1;154(1):39-43. doi: 10.1016/s0304-3835(00)00390-6.
85	Occupational exposure to polycyclic aromatic hydrocarbons in German industries: association between exogenous exposure and urinary metabolites and its modulation by enzyme polymorphisms. Toxicol Lett. 2005 Jul 4;157(3):241-55. doi: 10.1016/j.toxlet.2005.02.012. Epub 2005 Apr 8.
86	Human NAD(P)H:quinone oxidoreductase 1 (NQO1)-mediated inactivation of reactive quinoneimine metabolites of diclofenac and mefenamic acid. Chem Res Toxicol. 2014 Apr 21;27(4):576-86. doi: 10.1021/tx400431k. Epub 2014 Feb 26.
87	Polymorphisms of drug-metabolizing enzymes (GST, CYP2B6 and CYP3A) affect the pharmacokinetics of thiotepa and tepa. Br J Clin Pharmacol. 2009 Jan;67(1):50-60. doi: 10.1111/j.1365-2125.2008.03321.x. Epub 2008 Nov 17.