Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTMVHQOU)

DOT Name Homeobox protein Hox-B9 (HOXB9)
Synonyms Homeobox protein Hox-2.5; Homeobox protein Hox-2E
Gene Name HOXB9
Related Disease
Melanoma ( )
Acute lymphocytic leukaemia ( )
Adult glioblastoma ( )
Advanced cancer ( )
Arteriosclerosis ( )
Atherosclerosis ( )
Breast cancer ( )
Breast carcinoma ( )
Breast neoplasm ( )
Campomelic dysplasia ( )
Classic Hodgkin lymphoma ( )
Colorectal carcinoma ( )
Endometrial cancer ( )
Endometrial carcinoma ( )
Gastric cancer ( )
Glioblastoma multiforme ( )
Glioma ( )
Head-neck squamous cell carcinoma ( )
Hepatocellular carcinoma ( )
Laryngeal squamous cell carcinoma ( )
leukaemia ( )
Leukemia ( )
Malignant uterine tumour ( )
Matthew-Wood syndrome ( )
Neoplasm ( )
Neuroblastoma ( )
Non-small-cell lung cancer ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Pancreatic cancer ( )
Pancreatic ductal carcinoma ( )
Prostate cancer ( )
Prostate neoplasm ( )
Renal carcinoma ( )
Renal cell carcinoma ( )
Stomach cancer ( )
Tumor of uterus ( )
Acute myelogenous leukaemia ( )
Colon adenocarcinoma ( )
Colon cancer ( )
Colon carcinoma ( )
Lung adenocarcinoma ( )
Lung cancer ( )
Lung carcinoma ( )
Mesothelioma ( )
UniProt ID
HXB9_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00046 ; PF04617
Sequence
MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFG
ASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEP
LLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWL
HARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKM
KKMNKEQGKE
Function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Melanoma DIS1RRCY Definitive Biomarker [1]
Acute lymphocytic leukaemia DISPX75S Strong Biomarker [2]
Adult glioblastoma DISVP4LU Strong Genetic Variation [3]
Advanced cancer DISAT1Z9 Strong Biomarker [1]
Arteriosclerosis DISK5QGC Strong Biomarker [4]
Atherosclerosis DISMN9J3 Strong Biomarker [4]
Breast cancer DIS7DPX1 Strong Biomarker [5]
Breast carcinoma DIS2UE88 Strong Biomarker [5]
Breast neoplasm DISNGJLM Strong Biomarker [5]
Campomelic dysplasia DISVTW53 Strong Biomarker [6]
Classic Hodgkin lymphoma DISV1LU6 Strong Altered Expression [7]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [8]
Endometrial cancer DISW0LMR Strong Biomarker [9]
Endometrial carcinoma DISXR5CY Strong Biomarker [9]
Gastric cancer DISXGOUK Strong Altered Expression [10]
Glioblastoma multiforme DISK8246 Strong Genetic Variation [3]
Glioma DIS5RPEH Strong Biomarker [11]
Head-neck squamous cell carcinoma DISF7P24 Strong Altered Expression [12]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [13]
Laryngeal squamous cell carcinoma DIS9UUVF Strong Biomarker [14]
leukaemia DISS7D1V Strong Altered Expression [2]
Leukemia DISNAKFL Strong Altered Expression [2]
Malignant uterine tumour DIS3QDT8 Strong Biomarker [5]
Matthew-Wood syndrome DISA7HR7 Strong Biomarker [15]
Neoplasm DISZKGEW Strong Altered Expression [10]
Neuroblastoma DISVZBI4 Strong Altered Expression [3]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [16]
Ovarian cancer DISZJHAP Strong Biomarker [5]
Ovarian neoplasm DISEAFTY Strong Biomarker [5]
Pancreatic cancer DISJC981 Strong Altered Expression [8]
Pancreatic ductal carcinoma DIS26F9Q Strong Biomarker [15]
Prostate cancer DISF190Y Strong Biomarker [5]
Prostate neoplasm DISHDKGQ Strong Biomarker [5]
Renal carcinoma DISER9XT Strong Genetic Variation [17]
Renal cell carcinoma DISQZ2X8 Strong Genetic Variation [17]
Stomach cancer DISKIJSX Strong Altered Expression [10]
Tumor of uterus DIS5Z2HI Strong Biomarker [5]
Acute myelogenous leukaemia DISCSPTN Limited Altered Expression [18]
Colon adenocarcinoma DISDRE0J Limited Altered Expression [19]
Colon cancer DISVC52G Limited Altered Expression [15]
Colon carcinoma DISJYKUO Limited Altered Expression [15]
Lung adenocarcinoma DISD51WR Limited Altered Expression [15]
Lung cancer DISCM4YA Limited Biomarker [20]
Lung carcinoma DISTR26C Limited Biomarker [20]
Mesothelioma DISKWK9M Limited Altered Expression [21]
------------------------------------------------------------------------------------
⏷ Show the Full List of 45 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Homeobox protein Hox-B9 (HOXB9). [22]
Arsenic DMTL2Y1 Approved Arsenic increases the methylation of Homeobox protein Hox-B9 (HOXB9). [26]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Homeobox protein Hox-B9 (HOXB9). [33]
------------------------------------------------------------------------------------
16 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Homeobox protein Hox-B9 (HOXB9). [23]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Homeobox protein Hox-B9 (HOXB9). [24]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Homeobox protein Hox-B9 (HOXB9). [5]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Homeobox protein Hox-B9 (HOXB9). [27]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Homeobox protein Hox-B9 (HOXB9). [28]
Triclosan DMZUR4N Approved Triclosan increases the expression of Homeobox protein Hox-B9 (HOXB9). [29]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of Homeobox protein Hox-B9 (HOXB9). [30]
Nicotine DMWX5CO Approved Nicotine increases the expression of Homeobox protein Hox-B9 (HOXB9). [31]
Thalidomide DM70BU5 Approved Thalidomide increases the expression of Homeobox protein Hox-B9 (HOXB9). [32]
Phenytoin DMNOKBV Approved Phenytoin increases the expression of Homeobox protein Hox-B9 (HOXB9). [32]
Nilotinib DM7HXWT Approved Nilotinib increases the expression of Homeobox protein Hox-B9 (HOXB9). [32]
Abacavir DMMN36E Approved Abacavir increases the expression of Homeobox protein Hox-B9 (HOXB9). [32]
Dabigatran DMDI6R4 Approved Dabigatran increases the expression of Homeobox protein Hox-B9 (HOXB9). [32]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Homeobox protein Hox-B9 (HOXB9). [34]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Homeobox protein Hox-B9 (HOXB9). [35]
Manganese DMKT129 Investigative Manganese decreases the expression of Homeobox protein Hox-B9 (HOXB9). [36]
------------------------------------------------------------------------------------
⏷ Show the Full List of 16 Drug(s)

References

1 Regulation of Cancer Stem Cell Self-Renewal by HOXB9 Antagonizes Endoplasmic Reticulum Stress-Induced Melanoma Cell Apoptosis via the miR-765-FOXA2 Axis.J Invest Dermatol. 2018 Jul;138(7):1609-1619. doi: 10.1016/j.jid.2018.01.023. Epub 2018 Feb 3.
2 Expression of selected human HOX-2 genes in B/T acute lymphoid leukemia and interleukin-2/interleukin-1 beta-stimulated natural killer lymphocytes.Blood. 1992 Jul 1;80(1):185-93.
3 Modulation of HOX2 gene expression following differentiation of neuronal cell lines.Differentiation. 1992 Sep;51(1):39-47. doi: 10.1111/j.1432-0436.1992.tb00678.x.
4 Homeobox B9 integrates bone morphogenic protein 4 with inflammation at atheroprone sites.Cardiovasc Res. 2020 Jun 1;116(7):1300-1310. doi: 10.1093/cvr/cvz235.
5 Endocrine disrupting chemical, bisphenol-A, induces breast cancer associated gene HOXB9 expression in vitro and in vivo. Gene. 2016 Sep 30;590(2):234-43. doi: 10.1016/j.gene.2016.05.009. Epub 2016 May 13.
6 Assignment of an autosomal sex reversal locus (SRA1) and campomelic dysplasia (CMPD1) to 17q24.3-q25.1.Nat Genet. 1993 Jun;4(2):170-4. doi: 10.1038/ng0693-170.
7 Comprehensive analysis of homeobox genes in Hodgkin lymphoma cell lines identifies dysregulated expression of HOXB9 mediated via ERK5 signaling and BMI1.Blood. 2007 Apr 1;109(7):3015-23. doi: 10.1182/blood-2006-08-044347.
8 Homeobox B9 Mediates Resistance to Anti-VEGF Therapy in Colorectal Cancer Patients.Clin Cancer Res. 2017 Aug 1;23(15):4312-4322. doi: 10.1158/1078-0432.CCR-16-3153. Epub 2017 Mar 15.
9 HOXB9 promotes endometrial cancer progression by targeting E2F3.Cell Death Dis. 2018 May 1;9(5):509. doi: 10.1038/s41419-018-0556-3.
10 Experimental and clinicopathological analysis of HOXB9 in gastric cancer.Oncol Lett. 2019 Mar;17(3):3097-3102. doi: 10.3892/ol.2019.10008. Epub 2019 Feb 4.
11 Overexpressed homeobox B9 regulates oncogenic activities by transforming growth factor-1 in gliomas.Biochem Biophys Res Commun. 2014 Mar 28;446(1):272-9. doi: 10.1016/j.bbrc.2014.02.095. Epub 2014 Feb 28.
12 The role of HOXB9 and miR-196a in head and neck squamous cell carcinoma.PLoS One. 2015 Apr 10;10(4):e0122285. doi: 10.1371/journal.pone.0122285. eCollection 2015.
13 GRP78 activates the Wnt/HOXB9 pathway to promote invasion and metastasis of hepatocellular carcinoma by chaperoning LRP6.Exp Cell Res. 2019 Oct 1;383(1):111493. doi: 10.1016/j.yexcr.2019.07.006. Epub 2019 Jul 13.
14 Aberrant expressed long non-coding RNAs in laryngeal squamous-cell carcinoma.Am J Otolaryngol. 2019 Sep-Oct;40(5):615-625. doi: 10.1016/j.amjoto.2019.05.002. Epub 2019 May 9.
15 Acetylated HOXB9 at lysine 27 is of differential diagnostic value in patients with pancreatic ductal adenocarcinoma.Front Med. 2020 Feb;14(1):91-100. doi: 10.1007/s11684-019-0696-6. Epub 2019 Aug 2.
16 GalNAc-T14 promotes metastasis through Wnt dependent HOXB9 expression in lung adenocarcinoma.Oncotarget. 2015 Dec 8;6(39):41916-28. doi: 10.18632/oncotarget.6019.
17 HOX gene expression in normal and neoplastic human kidney.Int J Cancer. 1992 Jul 30;51(6):892-7. doi: 10.1002/ijc.2910510610.
18 Characteristic patterns of HOX gene expression in different types of human leukemia.Int J Cancer. 1993 Jan 21;53(2):237-44. doi: 10.1002/ijc.2910530211.
19 Elevated HOXB9 expression promotes differentiation and predicts a favourable outcome in colon adenocarcinoma patients.Br J Cancer. 2014 Aug 26;111(5):883-93. doi: 10.1038/bjc.2014.387. Epub 2014 Jul 15.
20 PCAF-mediated acetylation of transcriptional factor HOXB9 suppresses lung adenocarcinoma progression by targeting oncogenic protein JMJD6.Nucleic Acids Res. 2016 Dec 15;44(22):10662-10675. doi: 10.1093/nar/gkw808. Epub 2016 Sep 8.
21 Altered HOX and WNT7A expression in human lung cancer.Proc Natl Acad Sci U S A. 2000 Nov 7;97(23):12776-81. doi: 10.1073/pnas.97.23.12776.
22 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
23 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
24 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
25 Endocrine disrupting chemical, bisphenol-A, induces breast cancer associated gene HOXB9 expression in vitro and in vivo. Gene. 2016 Sep 30;590(2):234-43. doi: 10.1016/j.gene.2016.05.009. Epub 2016 May 13.
26 Epigenetic changes in individuals with arsenicosis. Chem Res Toxicol. 2011 Feb 18;24(2):165-7. doi: 10.1021/tx1004419. Epub 2011 Feb 4.
27 Gene expression profile induced by arsenic trioxide in chronic lymphocytic leukemia cells reveals a central role for heme oxygenase-1 in apoptosis and regulation of matrix metalloproteinase-9. Oncotarget. 2016 Dec 13;7(50):83359-83377.
28 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
29 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
30 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
31 Characterizing the genetic basis for nicotine induced cancer development: a transcriptome sequencing study. PLoS One. 2013 Jun 18;8(6):e67252.
32 Exposure-based assessment of chemical teratogenicity using morphogenetic aggregates of human embryonic stem cells. Reprod Toxicol. 2020 Jan;91:74-91. doi: 10.1016/j.reprotox.2019.10.004. Epub 2019 Nov 8.
33 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
34 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
35 Cultured human peripheral blood mononuclear cells alter their gene expression when challenged with endocrine-disrupting chemicals. Toxicology. 2013 Jan 7;303:17-24.
36 Gene expression profiling of human primary astrocytes exposed to manganese chloride indicates selective effects on several functions of the cells. Neurotoxicology. 2007 May;28(3):478-89.