Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTODVH8K)

• DOT Name: Desmocollin-2 (DSC2)
• Synonyms: Cadherin family member 2; Desmocollin-3; Desmosomal glycoprotein II; Desmosomal glycoprotein III
• Gene Name: DSC2
• Related Disease:
  Arrhythmogenic right ventricular dysplasia 11
  Carcinoma
  Familial isolated arrhythmogenic right ventricular dysplasia
  Advanced cancer
  Alopecia
  Autoimmune disease
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Carcinoma of esophagus
  Cardiac disease
  Colonic neoplasm
  Colorectal carcinoma
  Cowden disease
  Crohn disease
  Epidermolysis bullosa
  Epithelial ovarian cancer
  Esophageal cancer
  Gastric cancer
  Hereditary hypotrichosis with recurrent skin vesicles
  Hypotrichosis
  Lung cancer
  Lung carcinoma
  Metastatic malignant neoplasm
  Naxos disease
  Neoplasm
  Neoplasm of esophagus
  Non-small-cell lung cancer
  Pemphigus
  Skin disease
  Skin neoplasm
  Stomach cancer
  Wooly hair-palmoplantar keratoderma syndrome
  Adenocarcinoma
  Colitis
  Colorectal neoplasm
  Neuroendocrine cancer
  Pemphigus vulgaris
  Prostate cancer
  Prostate carcinoma
  Squamous cell carcinoma
  Arrhythmogenic right ventricular cardiomyopathy
  Arrhythmia
  Cardiomyopathy
  Colorectal adenoma
  Esophageal squamous cell carcinoma
• UniProt ID: DSC2_HUMAN
• PDB ID: 5ERP; 5J5J; 7A7D
• Pfam ID: PF01049 ; PF00028 ; PF08758
• Sequence:
  MEAARPSGSWNGALCRLLLLTLAILIFASDACKNVTLHVPSKLDAEKLVGRVNLKECFTA
  ANLIHSSDPDFQILEDGSVYTTNTILLSSEKRSFTILLSNTENQEKKKIFVFLEHQTKVL
  KKRHTKEKVLRRAKRRWAPIPCSMLENSLGPFPLFLQQVQSDTAQNYTIYYSIRGPGVDQ
  EPRNLFYVERDTGNLYCTRPVDREQYESFEIIAFATTPDGYTPELPLPLIIKIEDENDNY
  PIFTEETYTFTIFENCRVGTTVGQVCATDKDEPDTMHTRLKYSIIGQVPPSPTLFSMHPT
  TGVITTTSSQLDRELIDKYQLKIKVQDMDGQYFGLQTTSTCIINIDDVNDHLPTFTRTSY
  VTSVEENTVDVEILRVTVEDKDLVNTANWRANYTILKGNENGNFKIVTDAKTNEGVLCVV
  KPLNYEEKQQMILQIGVVNEAPFSREASPRSAMSTATVTVNVEDQDEGPECNPPIQTVRM
  KENAEVGTTSNGYKAYDPETRSSSGIRYKKLTDPTGWVTIDENTGSIKVFRSLDREAETI
  KNGIYNITVLASDQGGRTCTGTLGIILQDVNDNSPFIPKKTVIICKPTMSSAEIVAVDPD
  EPIHGPPFDFSLESSTSEVQRMWRLKAINDTAARLSYQNDPPFGSYVVPITVRDRLGMSS
  VTSLDVTLCDCITENDCTHRVDPRIGGGGVQLGKWAILAILLGIALLFCILFTLVCGASG
  TSKQPKVIPDDLAQQNLIVSNTEAPGDDKVYSANGFTTQTVGASAQGVCGTVGSGIKNGG
  QETIEMVKGGHQTSESCRGAGHHHTLDSCRGGHTEVDNCRYTYSEWHSFTQPRLGEKVYL
  CNQDENHKHAQDYVLTYNYEGRGSVAGSVGCCSERQEEDGLEFLDNLEPKFRTLAEACMK
  R
• Function: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. May contribute to epidermal cell positioning (stratification) by mediating differential adhesiveness between cells that express different isoforms.
• Tissue Specificity: Expressed in the heart (at protein level).
• KEGG Pathway:
  Cytoskeleton in muscle cells (hsa04820)
  Arrhythmogenic right ventricular cardiomyopathy (hsa05412)
• Reactome Pathway:
  Formation of the cornified envelope (R-HSA-6809371)
  Keratinization (R-HSA-6805567)

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Arrhythmogenic right ventricular dysplasia 11	DISL3MYG	Definitive	Semidominant	[1]
Carcinoma	DISH9F1N	Definitive	Biomarker	[2]
Familial isolated arrhythmogenic right ventricular dysplasia	DISBIOAZ	Definitive	Autosomal dominant	[3]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[4]
Alopecia	DIS37HU4	Strong	Genetic Variation	[5]
Autoimmune disease	DISORMTM	Strong	Biomarker	[6]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[7]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[7]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[7]
Carcinoma of esophagus	DISS6G4D	Strong	Altered Expression	[8]
Cardiac disease	DISVO1I5	Strong	Altered Expression	[9]
Colonic neoplasm	DISSZ04P	Strong	Altered Expression	[10]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[11]
Cowden disease	DISMYKCE	Strong	Biomarker	[12]
Crohn disease	DIS2C5Q8	Strong	Biomarker	[12]
Epidermolysis bullosa	DISVOTZQ	Strong	Genetic Variation	[13]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[14]
Esophageal cancer	DISGB2VN	Strong	Altered Expression	[8]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[15]
Hereditary hypotrichosis with recurrent skin vesicles	DISMD9UB	Strong	Genetic Variation	[16]
Hypotrichosis	DISSW933	Strong	Genetic Variation	[13]
Lung cancer	DISCM4YA	Strong	Biomarker	[17]
Lung carcinoma	DISTR26C	Strong	Biomarker	[17]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[18]
Naxos disease	DISL5ZUP	Strong	Genetic Variation	[19]
Neoplasm	DISZKGEW	Strong	Biomarker	[11]
Neoplasm of esophagus	DISOLKAQ	Strong	Altered Expression	[8]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[20]
Pemphigus	DISZAZ6M	Strong	Biomarker	[21]
Skin disease	DISDW8R6	Strong	Biomarker	[13]
Skin neoplasm	DIS16DDV	Strong	Biomarker	[22]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[15]
Wooly hair-palmoplantar keratoderma syndrome	DISVR3QA	Strong	Genetic Variation	[23]
Adenocarcinoma	DIS3IHTY	moderate	Altered Expression	[24]
Colitis	DISAF7DD	moderate	Altered Expression	[24]
Colorectal neoplasm	DISR1UCN	moderate	Biomarker	[24]
Neuroendocrine cancer	DISVGJET	moderate	Genetic Variation	[25]
Pemphigus vulgaris	DISENR62	moderate	Biomarker	[26]
Prostate cancer	DISF190Y	moderate	Biomarker	[4]
Prostate carcinoma	DISMJPLE	moderate	Biomarker	[4]
Squamous cell carcinoma	DISQVIFL	moderate	Biomarker	[25]
Arrhythmogenic right ventricular cardiomyopathy	DIS3V2BE	Disputed	Genetic Variation	[27]
Arrhythmia	DISFF2NI	Limited	Genetic Variation	[28]
Cardiomyopathy	DISUPZRG	Limited	Genetic Variation	[29]
Colorectal adenoma	DISTSVHM	Limited	Autosomal dominant	[1]
Esophageal squamous cell carcinoma	DIS5N2GV	Limited	Biomarker	[30]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic trioxide	DM61TA4	Approved	Desmocollin-2 (DSC2) decreases the response to substance of Arsenic trioxide.	[55]

25 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Desmocollin-2 (DSC2).	[31]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Desmocollin-2 (DSC2).	[32]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Desmocollin-2 (DSC2).	[33]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Desmocollin-2 (DSC2).	[34]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Desmocollin-2 (DSC2).	[35]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Desmocollin-2 (DSC2).	[36]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Desmocollin-2 (DSC2).	[37]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Desmocollin-2 (DSC2).	[38]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Desmocollin-2 (DSC2).	[39]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Desmocollin-2 (DSC2).	[38]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Desmocollin-2 (DSC2).	[40]
Selenium	DM25CGV	Approved	Selenium decreases the expression of Desmocollin-2 (DSC2).	[41]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Desmocollin-2 (DSC2).	[39]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Desmocollin-2 (DSC2).	[42]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Desmocollin-2 (DSC2).	[43]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Desmocollin-2 (DSC2).	[44]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Desmocollin-2 (DSC2).	[45]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Desmocollin-2 (DSC2).	[41]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Desmocollin-2 (DSC2).	[46]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Desmocollin-2 (DSC2).	[47]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Desmocollin-2 (DSC2).	[48]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Desmocollin-2 (DSC2).	[51]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Desmocollin-2 (DSC2).	[52]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Desmocollin-2 (DSC2).	[53]
Nitrobenzanthrone	DMN6L70	Investigative	Nitrobenzanthrone decreases the expression of Desmocollin-2 (DSC2).	[54]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Desmocollin-2 (DSC2).	[49]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Desmocollin-2 (DSC2).	[50]

References

• [1] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [2] Loss of desmocollin 1-3 and homeobox genes PITX1 and CDX2 are associated with tumor progression and survival in colorectal carcinoma.Int J Colorectal Dis. 2012 Nov;27(11):1391-9. doi: 10.1007/s00384-012-1460-4. Epub 2012 Mar 23.
• [3] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [4] Association of DSC3 mRNA down-regulation in prostate cancer with promoter hypermethylation and poor prognosis.PLoS One. 2014 Mar 24;9(3):e92815. doi: 10.1371/journal.pone.0092815. eCollection 2014.
• [5] A novel homozygous variant in the dsp gene underlies the first case of non-syndromic form of alopecia.Arch Dermatol Res. 2015 Nov;307(9):793-801. doi: 10.1007/s00403-015-1590-y. Epub 2015 Jul 7.
• [6] Matching NLR Immune Receptors to Autoimmunity in camta3 Mutants Using Antimorphic NLR Alleles.Cell Host Microbe. 2017 Apr 12;21(4):518-529.e4. doi: 10.1016/j.chom.2017.03.005.
• [7] Down-regulation of the desmosomal cadherin desmocollin 3 in human breast cancer.Int J Oncol. 2001 Jul;19(1):169-74. doi: 10.3892/ijo.19.1.169.
• [8] Reduced membranous and ectopic cytoplasmic expression of DSC2 in esophageal squamous cell carcinoma: an independent prognostic factor.Hum Pathol. 2010 Oct;41(10):1456-65. doi: 10.1016/j.humpath.2010.04.003.
• [9] The aberrant expression or disruption of desmocollin2 in human diseases.Int J Biol Macromol. 2019 Jun 15;131:378-386. doi: 10.1016/j.ijbiomac.2019.03.041. Epub 2019 Mar 6.
• [10] Repression of the desmocollin 2 gene expression in human colon cancer cells is relieved by the homeodomain transcription factors Cdx1 and Cdx2.Mol Cancer Res. 2008 Sep;6(9):1478-90. doi: 10.1158/1541-7786.MCR-07-2161.
• [11] Desmocollin 3 has a tumor suppressive activity through inhibition of AKT pathway in colorectal cancer.Exp Cell Res. 2019 May 15;378(2):124-130. doi: 10.1016/j.yexcr.2019.03.015. Epub 2019 Mar 8.
• [12] Desmoglein 2, but not desmocollin 2, protects intestinal epithelia from injury.Mucosal Immunol. 2018 Nov;11(6):1630-1639. doi: 10.1038/s41385-018-0062-z. Epub 2018 Aug 16.
• [13] Desmosomal genodermatoses.Br J Dermatol. 2012 Jan;166(1):36-45. doi: 10.1111/j.1365-2133.2011.10640.x.
• [14] Desmocollin 3 mediates follicle stimulating hormone-induced ovarian epithelial cancer cell proliferation by activating the EGFR/Akt signaling pathway.Int J Clin Exp Pathol. 2015 Jun 1;8(6):6716-23. eCollection 2015.
• [15] Clinicopathologic and molecular characteristics of gastric cancer showing gastric and intestinal mucin phenotype.Cancer Sci. 2015 Aug;106(8):951-8. doi: 10.1111/cas.12706. Epub 2015 Jul 7.
• [16] A homozygous nonsense mutation in the human desmocollin-3 (DSC3) gene underlies hereditary hypotrichosis and recurrent skin vesicles. Am J Hum Genet. 2009 Oct;85(4):515-20. doi: 10.1016/j.ajhg.2009.08.015. Epub 2009 Sep 17.
• [17] The p53 target gene desmocollin 3 acts as a novel tumor suppressor through inhibiting EGFR/ERK pathway in human lung cancer.Carcinogenesis. 2012 Dec;33(12):2326-33. doi: 10.1093/carcin/bgs273. Epub 2012 Aug 31.
• [18] Desmocollin? affects the adhesive strength and cytoskeletal arrangement in esophageal squamous cell carcinoma cells.Mol Med Rep. 2014 Nov;10(5):2358-64. doi: 10.3892/mmr.2014.2485. Epub 2014 Aug 12.
• [19] Two Novel Homozygous Desmoplakin Mutations in Carvajal Syndrome.Pediatr Dermatol. 2015 Sep-Oct;32(5):641-6. doi: 10.1111/pde.12541. Epub 2015 Mar 30.
• [20] A randomized trial of TLR-2 agonist CADI-05 targeting desmocollin-3 for advanced non-small-cell lung cancer.Ann Oncol. 2017 Feb 1;28(2):298-304. doi: 10.1093/annonc/mdw608.
• [21] Development of a Desmocollin-3 Active Mouse Model Recapitulating Human Atypical Pemphigus.Front Immunol. 2019 Jun 19;10:1387. doi: 10.3389/fimmu.2019.01387. eCollection 2019.
• [22] Loss of Desmocollin 3 in skin tumor development and progression.Mol Carcinog. 2012 Jul;51(7):535-45. doi: 10.1002/mc.20818. Epub 2011 Jun 16.
• [23] Homozygous mutation of desmocollin-2 in arrhythmogenic right ventricular cardiomyopathy with mild palmoplantar keratoderma and woolly hair. Cardiology. 2009;113(1):28-34. doi: 10.1159/000165696. Epub 2008 Oct 29.
• [24] Desmocollin switching in colorectal cancer.Br J Cancer. 2006 Nov 20;95(10):1367-70. doi: 10.1038/sj.bjc.6603453. Epub 2006 Oct 31.
• [25] Expression of squamous cell carcinoma markers and adenocarcinoma markers in primary pulmonary neuroendocrine carcinomas.Appl Immunohistochem Mol Morphol. 2013 Jul;21(4):292-7. doi: 10.1097/PAI.0b013e31826fd4f3.
• [26] Synergy among non-desmoglein antibodies contributes to the immunopathology of desmoglein antibody-negative pemphigus vulgaris.J Biol Chem. 2019 Mar 22;294(12):4520-4528. doi: 10.1074/jbc.RA118.006743. Epub 2019 Jan 28.
• [27] Targeted panel sequencing in pediatric primary cardiomyopathy supports a critical role of TNNI3.Clin Genet. 2019 Dec;96(6):549-559. doi: 10.1111/cge.13645. Epub 2019 Oct 22.
• [28] Malignant Arrhythmia with Variants of Desmocollin-2 and Desmoplakin Genes.Int Heart J. 2019 Sep 27;60(5):1196-1200. doi: 10.1536/ihj.18-681. Epub 2019 Sep 4.
• [29] Minimal inflammatory foci of unknown etiology may be a tentative sign of early stage inherited cardiomyopathy.Mod Pathol. 2019 Sep;32(9):1281-1290. doi: 10.1038/s41379-019-0274-0. Epub 2019 Apr 25.
• [30] miR-92b-3p Functions As A Key Gene In Esophageal Squamous Cell Cancer As Determined By Co-Expression Analysis.Onco Targets Ther. 2019 Oct 14;12:8339-8353. doi: 10.2147/OTT.S220823. eCollection 2019.
• [31] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [32] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [33] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [34] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [35] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [36] Epidermal growth factor receptor signalling in human breast cancer cells operates parallel to estrogen receptor alpha signalling and results in tamoxifen insensitive proliferation. BMC Cancer. 2014 Apr 23;14:283.
• [37] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [38] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [39] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [40] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [41] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [42] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [43] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [44] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [45] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [46] Comparative mechanisms of PAH toxicity by benzo[a]pyrene and dibenzo[def,p]chrysene in primary human bronchial epithelial cells cultured at air-liquid interface. Toxicol Appl Pharmacol. 2019 Sep 15;379:114644.
• [47] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [48] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [49] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [50] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [51] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [52] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [53] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [54] 3-Nitrobenzanthrone promotes malignant transformation in human lung epithelial cells through the epiregulin-signaling pathway. Cell Biol Toxicol. 2022 Oct;38(5):865-887. doi: 10.1007/s10565-021-09612-1. Epub 2021 May 25.
• [55] The NRF2-mediated oxidative stress response pathway is associated with tumor cell resistance to arsenic trioxide across the NCI-60 panel. BMC Med Genomics. 2010 Aug 13;3:37. doi: 10.1186/1755-8794-3-37.