Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQKE6V4)

• DOT Name: GRB2-associated-binding protein 1 (GAB1)
• Synonyms: GRB2-associated binder 1; Growth factor receptor bound protein 2-associated protein 1
• Gene Name: GAB1
• Related Disease:
  Adult glioblastoma
  Asthma
  Glioblastoma multiforme
  Tuberculosis
  Acute erythroid leukemia
  Allergic asthma
  Alzheimer disease
  Breast carcinoma
  Breast neoplasm
  Cardiac failure
  Congestive heart failure
  Dilated cardiomyopathy
  Dilated cardiomyopathy 1A
  Epithelial ovarian cancer
  Ewing sarcoma
  Gastric adenocarcinoma
  Gastric cancer
  Glioma
  Head-neck squamous cell carcinoma
  Hepatocellular carcinoma
  Intrahepatic cholangiocarcinoma
  Lung cancer
  Lung carcinoma
  Medulloblastoma
  Melanoma
  Non-small-cell lung cancer
  Ovarian cancer
  Ovarian neoplasm
  Plasma cell myeloma
  Prostate cancer
  Prostate carcinoma
  Pulmonary fibrosis
  Sarcoma
  Small lymphocytic lymphoma
  Stomach cancer
  Synovial sarcoma
  Systemic sclerosis
  Transitional cell carcinoma
  Urothelial carcinoma
  Acute myelogenous leukaemia
  Colorectal carcinoma
  Neoplasm
  Polycystic ovarian syndrome
  Advanced cancer
  Autosomal recessive nonsyndromic hearing loss 26
  Breast cancer
  Squamous cell carcinoma
• UniProt ID: GAB1_HUMAN
• PDB ID: 4QSY
• Pfam ID: PF00169
• Sequence:
  MSGGEVVCSGWLRKSPPEKKLKRYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRII
  DLNLCQQVDAGLTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVRCICDICGFNPT
  EEDPVKPPGSSLQAPADLPLAINTAPPSTQADSSSATLPPPYQLINVPPHLETLGIQEDP
  QDYLLLINCQSKKPEPTRTHADSAKSTSSETDCNDNVPSHKNPASSQSKHGMNGFFQQQM
  IYDSPPSRAPSASVDSSLYNLPRSYSHDVLPKVSPSSTEADGELYVFNTPSGTSSVETQM
  RHVSISYDIPPTPGNTYQIPRTFPEGTLGQTSKLDTIPDIPPPRPPKPHPAHDRSPVETC
  SIPRTASDTDSSYCIPTAGMSPSRSNTISTVDLNKLRKDASSQDCYDIPRAFPSDRSSSL
  EGFHNHFKVKNVLTVGSVSSEELDENYVPMNPNSPPRQHSSSFTEPIQEANYVPMTPGTF
  DFSSFGMQVPPPAHMGFRSSPKTPPRRPVPVADCEPPPVDRNLKPDRKVKPAPLEIKPLP
  EWEELQAPVRSPITRSFARDSSRFPMSPRPDSVHSTTSSSDSHDSEENYVPMNPNLSSED
  PNLFGSNSLDGGSSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSVADERVDYV
  VVDQQKTLALKSTREAWTDGRQSTESETPAKSVK
• Function: Adapter protein that plays a role in intracellular signaling cascades triggered by activated receptor-type kinases. Plays a role in FGFR1 signaling. Probably involved in signaling by the epidermal growth factor receptor (EGFR) and the insulin receptor (INSR). Involved in the MET/HGF-signaling pathway.
• KEGG Pathway:
  EGFR tyrosine ki.se inhibitor resistance (hsa01521)
  ErbB sig.ling pathway (hsa04012)
  Ras sig.ling pathway (hsa04014)
  Phospholipase D sig.ling pathway (hsa04072)
  Neurotrophin sig.ling pathway (hsa04722)
  Bacterial invasion of epithelial cells (hsa05100)
  Proteoglycans in cancer (hsa05205)
  Re.l cell carcinoma (hsa05211)
  Hepatocellular carcinoma (hsa05225)
  Gastric cancer (hsa05226)
• Reactome Pathway:
  Constitutive Signaling by Ligand-Responsive EGFR Cancer Variants (R-HSA-1236382)
  PIP3 activates AKT signaling (R-HSA-1257604)
  GAB1 signalosome (R-HSA-180292)
  PI3K events in ERBB2 signaling (R-HSA-1963642)
  Constitutive Signaling by Aberrant PI3K in Cancer (R-HSA-2219530)
  Constitutive Signaling by EGFRvIII (R-HSA-5637810)
  PI-3K cascade (R-HSA-5654689)
  PI-3K cascade (R-HSA-5654695)
  PI-3K cascade (R-HSA-5654710)
  PI-3K cascade (R-HSA-5654720)
  Signaling by FGFR2 in disease (R-HSA-5655253)
  Signaling by FGFR4 in disease (R-HSA-5655291)
  Signaling by FGFR1 in disease (R-HSA-5655302)
  Signaling by FGFR3 in disease (R-HSA-5655332)
  PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling (R-HSA-6811558)
  MET activates PI3K/AKT signaling (R-HSA-8851907)
  RET signaling (R-HSA-8853659)
  MET activates PTPN11 (R-HSA-8865999)
  MET activates RAP1 and RAC1 (R-HSA-8875555)
  MET receptor recycling (R-HSA-8875656)
  Erythropoietin activates Phosphoinositide-3-kinase (PI3K) (R-HSA-9027276)
  Activated NTRK2 signals through PI3K (R-HSA-9028335)
  Signaling by ERBB2 KD Mutants (R-HSA-9664565)
  Signaling by ERBB2 ECD mutants (R-HSA-9665348)
  PI3K Cascade (R-HSA-109704)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult glioblastoma	DISVP4LU	Definitive	Biomarker	[1]
Asthma	DISW9QNS	Definitive	Biomarker	[2]
Glioblastoma multiforme	DISK8246	Definitive	Biomarker	[1]
Tuberculosis	DIS2YIMD	Definitive	Altered Expression	[3]
Acute erythroid leukemia	DISZFC1O	Strong	Genetic Variation	[4]
Allergic asthma	DISHF0H3	Strong	Biomarker	[2]
Alzheimer disease	DISF8S70	Strong	Biomarker	[5]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[6]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[7]
Cardiac failure	DISDC067	Strong	Genetic Variation	[8]
Congestive heart failure	DIS32MEA	Strong	Genetic Variation	[8]
Dilated cardiomyopathy	DISX608J	Strong	Genetic Variation	[8]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Biomarker	[8]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[6]
Ewing sarcoma	DISQYLV3	Strong	Altered Expression	[9]
Gastric adenocarcinoma	DISWWLTC	Strong	Biomarker	[10]
Gastric cancer	DISXGOUK	Strong	Biomarker	[10]
Glioma	DIS5RPEH	Strong	Altered Expression	[11]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[12]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[13]
Intrahepatic cholangiocarcinoma	DIS6GOC8	Strong	Biomarker	[14]
Lung cancer	DISCM4YA	Strong	Genetic Variation	[15]
Lung carcinoma	DISTR26C	Strong	Genetic Variation	[15]
Medulloblastoma	DISZD2ZL	Strong	Altered Expression	[16]
Melanoma	DIS1RRCY	Strong	Biomarker	[17]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[18]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[6]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[6]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[19]
Prostate cancer	DISF190Y	Strong	Altered Expression	[20]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[20]
Pulmonary fibrosis	DISQKVLA	Strong	Biomarker	[21]
Sarcoma	DISZDG3U	Strong	Biomarker	[9]
Small lymphocytic lymphoma	DIS30POX	Strong	Altered Expression	[22]
Stomach cancer	DISKIJSX	Strong	Biomarker	[10]
Synovial sarcoma	DISEZJS7	Strong	Posttranslational Modification	[23]
Systemic sclerosis	DISF44L6	Strong	Altered Expression	[24]
Transitional cell carcinoma	DISWVVDR	Strong	Biomarker	[25]
Urothelial carcinoma	DISRTNTN	Strong	Biomarker	[25]
Acute myelogenous leukaemia	DISCSPTN	moderate	Genetic Variation	[26]
Colorectal carcinoma	DIS5PYL0	moderate	Biomarker	[6]
Neoplasm	DISZKGEW	moderate	Biomarker	[27]
Polycystic ovarian syndrome	DISZ2BNG	moderate	Altered Expression	[28]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[29]
Autosomal recessive nonsyndromic hearing loss 26	DISQQMKS	Limited	Unknown	[30]
Breast cancer	DIS7DPX1	Limited	Altered Expression	[6]
Squamous cell carcinoma	DISQVIFL	Limited	Biomarker	[31]

19 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of GRB2-associated-binding protein 1 (GAB1).	[32]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of GRB2-associated-binding protein 1 (GAB1).	[33]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of GRB2-associated-binding protein 1 (GAB1).	[34]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of GRB2-associated-binding protein 1 (GAB1).	[35]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of GRB2-associated-binding protein 1 (GAB1).	[36]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of GRB2-associated-binding protein 1 (GAB1).	[38]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of GRB2-associated-binding protein 1 (GAB1).	[39]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of GRB2-associated-binding protein 1 (GAB1).	[40]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of GRB2-associated-binding protein 1 (GAB1).	[41]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of GRB2-associated-binding protein 1 (GAB1).	[39]
Menthol	DMG2KW7	Approved	Menthol increases the expression of GRB2-associated-binding protein 1 (GAB1).	[42]
Permethrin	DMZ0Q1G	Approved	Permethrin increases the expression of GRB2-associated-binding protein 1 (GAB1).	[43]
Melphalan	DMOLNHF	Approved	Melphalan decreases the expression of GRB2-associated-binding protein 1 (GAB1).	[44]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of GRB2-associated-binding protein 1 (GAB1).	[45]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of GRB2-associated-binding protein 1 (GAB1).	[48]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of GRB2-associated-binding protein 1 (GAB1).	[49]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of GRB2-associated-binding protein 1 (GAB1).	[50]
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE	DMNQL17	Investigative	2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE increases the expression of GRB2-associated-binding protein 1 (GAB1).	[51]
Z-Pro-Prolinal	DM43O2U	Investigative	Z-Pro-Prolinal decreases the expression of GRB2-associated-binding protein 1 (GAB1).	[52]

5 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Quercetin	DM3NC4M	Approved	Quercetin decreases the phosphorylation of GRB2-associated-binding protein 1 (GAB1).	[37]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of GRB2-associated-binding protein 1 (GAB1).	[46]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of GRB2-associated-binding protein 1 (GAB1).	[47]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of GRB2-associated-binding protein 1 (GAB1).	[47]
NVP-TAE684	DMFZXI2	Investigative	NVP-TAE684 decreases the phosphorylation of GRB2-associated-binding protein 1 (GAB1).	[53]

References

• [1] Guanine nucleotide exchange factor Dock7 mediates HGF-induced glioblastoma cell invasion via Rac activation.Br J Cancer. 2014 Mar 4;110(5):1307-15. doi: 10.1038/bjc.2014.39. Epub 2014 Feb 11.
• [2] Scaffolding protein Gab1 regulates myeloid dendritic cell migration in allergic asthma.Cell Res. 2016 Nov;26(11):1226-1241. doi: 10.1038/cr.2016.124. Epub 2016 Nov 4.
• [3] Growth factor receptor bound protein 2-associated binder 2, a scaffolding adaptor protein, negatively regulates host immunity against tuberculosis.Am J Respir Cell Mol Biol. 2014 Oct;51(4):575-85. doi: 10.1165/rcmb.2013-0329OC.
• [4] The multi-site docking protein Gab1 is constitutively phosphorylated independent from its recruitment to the plasma membrane in Jak2-V617F-positive cells and mediates proliferation of human erythroleukaemia cells.Cell Signal. 2017 Jul;35:37-47. doi: 10.1016/j.cellsig.2017.03.021. Epub 2017 Mar 30.
• [5] Cholinergic Grb2-Associated-Binding Protein 1 Regulates Cognitive Function.Cereb Cortex. 2018 Jul 1;28(7):2391-2404. doi: 10.1093/cercor/bhx141.
• [6] Elevated expression of Gab1 promotes breast cancer metastasis by dissociating the PAR complex.J Exp Clin Cancer Res. 2019 Jan 21;38(1):27. doi: 10.1186/s13046-019-1025-2.
• [7] Hyaluronan-mediated CD44 interaction with RhoGEF and Rho kinase promotes Grb2-associated binder-1 phosphorylation and phosphatidylinositol 3-kinase signaling leading to cytokine (macrophage-colony stimulating factor) production and breast tumor progression.J Biol Chem. 2003 Aug 8;278(32):29420-34. doi: 10.1074/jbc.M301885200. Epub 2003 May 14.
• [8] Cardiac Gab1 deletion leads to dilated cardiomyopathy associated with mitochondrial damage and cardiomyocyte apoptosis.Cell Death Differ. 2016 Apr;23(4):695-706. doi: 10.1038/cdd.2015.143. Epub 2015 Oct 30.
• [9] Grb2-associated binding protein-1 as a biomarker in bone and soft tissue sarcomas.Pathology. 2019 Oct;51(6):610-614. doi: 10.1016/j.pathol.2019.05.003. Epub 2019 Aug 20.
• [10] Grb2-associated binder 1 polymorphism was associated with the risk of Helicobactor pylori infection and gastric atrophy.Int J Med Sci. 2006 Nov 1;4(1):1-6. doi: 10.7150/ijms.4.1.
• [11] MicroRNA-29a-3p Downregulation Causes Gab1 Upregulation to Promote Glioma Cell Proliferation.Cell Physiol Biochem. 2018;48(2):450-460. doi: 10.1159/000491776. Epub 2018 Jul 17.
• [12] Role of GRB2-associated binder 1 in epidermal growth factor receptor-induced signaling in head and neck squamous cell carcinoma.Int J Cancer. 2013 Mar 1;132(5):1042-50. doi: 10.1002/ijc.27763. Epub 2012 Aug 28.
• [13] ERRATUM.Oncol Res. 2019 Feb 5;27(2):281-282. doi: 10.3727/096504019X15476499940873.
• [14] Gab1 regulates proliferation and migration through the PI3K/Akt signaling pathway in intrahepatic cholangiocarcinoma.Tumour Biol. 2015 Nov;36(11):8367-77. doi: 10.1007/s13277-015-3590-0. Epub 2015 May 28.
• [15] Polymorphisms of rs1347093 and rs1397529 are associated with lung cancer risk in northeast Chinese population.Oncotarget. 2017 Oct 24;8(55):94862-94871. doi: 10.18632/oncotarget.22030. eCollection 2017 Nov 7.
• [16] Medulloblastoma, WNT-activated/SHH-activated: clinical impact of molecular analysis and histogenetic evaluation.Childs Nerv Syst. 2018 May;34(5):809-815. doi: 10.1007/s00381-018-3765-2. Epub 2018 Mar 26.
• [17] Protein kinase C-betaII represses hepatocyte growth factor-induced invasion by preventing the association of adapter protein Gab1 and phosphatidylinositol 3-kinase in melanoma cells.J Invest Dermatol. 2008 Jan;128(1):188-95. doi: 10.1038/sj.jid.5700961. Epub 2007 Jul 12.
• [18] MicroRNA-590-5p suppresses the proliferation and invasion of non-small cell lung cancer by regulating GAB1.Eur Rev Med Pharmacol Sci. 2018 Sep;22(18):5954-5963. doi: 10.26355/eurrev_201809_15926.
• [19] Critical role for hematopoietic cell kinase (Hck)-mediated phosphorylation of Gab1 and Gab2 docking proteins in interleukin 6-induced proliferation and survival of multiple myeloma cells.J Biol Chem. 2004 May 14;279(20):21658-65. doi: 10.1074/jbc.M305783200. Epub 2004 Mar 9.
• [20] beta1A integrin expression is required for type 1 insulin-like growth factor receptor mitogenic and transforming activities and localization to focal contacts.Cancer Res. 2005 Aug 1;65(15):6692-700. doi: 10.1158/0008-5472.CAN-04-4315.
• [21] Increased levels of Gab1 and Gab2 adaptor proteins skew interleukin-4 (IL-4) signaling toward M2 macrophage-driven pulmonary fibrosis in mice.J Biol Chem. 2017 Aug 25;292(34):14003-14015. doi: 10.1074/jbc.M117.802066. Epub 2017 Jul 7.
• [22] miR in CLL: more than mere markers of prognosis?.Blood. 2014 Jul 3;124(1):2-4. doi: 10.1182/blood-2014-05-574152.
• [23] Adaptor molecule Crk is required for sustained phosphorylation of Grb2-associated binder 1 and hepatocyte growth factor-induced cell motility of human synovial sarcoma cell lines.Mol Cancer Res. 2006 Jul;4(7):499-510. doi: 10.1158/1541-7786.MCR-05-0141.
• [24] Increased expression of GAB1 promotes inflammation and fibrosis in systemic sclerosis.Exp Dermatol. 2019 Nov;28(11):1313-1320. doi: 10.1111/exd.14033.
• [25] Gab1 is essential for membrane translocation, activity and integrity of mTORCs after EGF stimulation in urothelial cell carcinoma.Oncotarget. 2015 Jan 30;6(3):1478-89. doi: 10.18632/oncotarget.2756.
• [26] Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
• [27] In Vitro and In Vivo Activity of AMG 337, a Potent and Selective MET Kinase Inhibitor, in MET-Dependent Cancer Models.Mol Cancer Ther. 2016 Jul;15(7):1568-79. doi: 10.1158/1535-7163.MCT-15-0871. Epub 2016 Apr 19.
• [28] Characterization of GAB1 expression over the menstrual cycle in women with and without polycystic ovarian syndrome provides a new insight into its pathophysiology.J Clin Endocrinol Metab. 2014 Nov;99(11):E2162-8. doi: 10.1210/jc.2014-2128. Epub 2014 Aug 21.
• [29] MAPK-induced Gab1 translocation to the plasma membrane depends on a regulated intramolecular switch.Cell Signal. 2015 Feb;27(2):340-52. doi: 10.1016/j.cellsig.2014.11.017. Epub 2014 Nov 25.
• [30] Modifier variant of METTL13 suppresses human GAB1-associated profound deafness. J Clin Invest. 2018 Apr 2;128(4):1509-1522. doi: 10.1172/JCI97350. Epub 2018 Mar 12.
• [31] Knockdown of Gab1 Inhibits Cellular Proliferation, Migration, and Invasion in Human Oral Squamous Carcinoma Cells.Oncol Res. 2018 May 7;26(4):617-624. doi: 10.3727/096504017X15043589260618. Epub 2017 Sep 6.
• [32] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [33] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [34] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [35] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [36] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [37] Quercetin inhibits HGF/c-Met signaling and HGF-stimulated melanoma cell migration and invasion. Mol Cancer. 2015 May 14;14:103. doi: 10.1186/s12943-015-0367-4.
• [38] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [39] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [40] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [41] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [42] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [43] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [44] Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
• [45] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [46] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [47] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [48] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [49] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [50] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [51] Preferential induction of the AhR gene battery in HepaRG cells after a single or repeated exposure to heterocyclic aromatic amines. Toxicol Appl Pharmacol. 2010 Nov 15;249(1):91-100.
• [52] Prolyl endopeptidase is involved in cellular signalling in human neuroblastoma SH-SY5Y cells. Neurosignals. 2011;19(2):97-109. doi: 10.1159/000326342. Epub 2011 Apr 10.
• [53] Paracrine receptor activation by microenvironment triggers bypass survival signals and ALK inhibitor resistance in EML4-ALK lung cancer cells. Clin Cancer Res. 2012 Jul 1;18(13):3592-602. doi: 10.1158/1078-0432.CCR-11-2972. Epub 2012 May 2.