General Information of Drug Off-Target (DOT) (ID: OTR443C5)

DOT Name Transforming growth factor-beta-induced protein ig-h3 (TGFBI)
Synonyms Beta ig-h3; Kerato-epithelin; RGD-containing collagen-associated protein; RGD-CAP
Gene Name TGFBI
Related Disease
Granular corneal dystrophy type I ( )
Granular corneal dystrophy type II ( )
Lattice corneal dystrophy type I ( )
Reis-Bucklers corneal dystrophy ( )
Thiel-Behnke corneal dystrophy ( )
Adenocarcinoma ( )
Astrocytoma ( )
Bone osteosarcoma ( )
Breast cancer ( )
Breast carcinoma ( )
Diabetic kidney disease ( )
Epithelial ovarian cancer ( )
Esophageal squamous cell carcinoma ( )
Fuchs' endothelial dystrophy ( )
Gastric cancer ( )
Glioma ( )
Hepatocellular carcinoma ( )
Keratoconus ( )
leukaemia ( )
Leukemia ( )
Lung cancer ( )
Lung carcinoma ( )
Lung neoplasm ( )
Matthew-Wood syndrome ( )
Nasopharyngeal carcinoma ( )
Nephropathy ( )
Non-insulin dependent diabetes ( )
Non-small-cell lung cancer ( )
Osteoarthritis ( )
Osteosarcoma ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Pancreatic cancer ( )
Renal cell carcinoma ( )
Squamous cell carcinoma ( )
Stomach cancer ( )
Systemic sclerosis ( )
Transitional cell carcinoma ( )
Urothelial carcinoma ( )
Carcinoma ( )
Metastatic malignant neoplasm ( )
Stroke ( )
Epithelial basement membrane dystrophy ( )
Advanced cancer ( )
Amyloidosis ( )
Cataract ( )
Clear cell renal carcinoma ( )
Colorectal carcinoma ( )
Melanoma ( )
Type-1 diabetes ( )
UniProt ID
BGH3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1X3B; 2LTB; 2LTC; 2VXP; 5NV6; 7AS7; 7ASC; 7ASG; 8HGA; 8HIA
Pfam ID
PF02469
Sequence
MALFVRLLALALALALGPAATLAGPAKSPYQLVLQHSRLRGRQHGPNVCAVQKVIGTNRK
YFTNCKQWYQRKICGKSTVISYECCPGYEKVPGEKGCPAALPLSNLYETLGVVGSTTTQL
YTDRTEKLRPEMEGPGSFTIFAPSNEAWASLPAEVLDSLVSNVNIELLNALRYHMVGRRV
LTDELKHGMTLTSMYQNSNIQIHHYPNGIVTVNCARLLKADHHATNGVVHLIDKVISTIT
NNIQQIIEIEDTFETLRAAVAASGLNTMLEGNGQYTLLAPTNEAFEKIPSETLNRILGDP
EALRDLLNNHILKSAMCAEAIVAGLSVETLEGTTLEVGCSGDMLTINGKAIISNKDILAT
NGVIHYIDELLIPDSAKTLFELAAESDVSTAIDLFRQAGLGNHLSGSERLTLLAPLNSVF
KDGTPPIDAHTRNLLRNHIIKDQLASKYLYHGQTLETLGGKKLRVFVYRNSLCIENSCIA
AHDKRGRYGTLFTMDRVLTPPMGTVMDVLKGDNRFSMLVAAIQSAGLTETLNREGVYTVF
APTNEAFRALPPRERSRLLGDAKELANILKYHIGDEILVSGGIGALVRLKSLQGDKLEVS
LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSALEIFKQASAF
SRASQRSVRLAPVYQKLLERMKH
Function Plays a role in cell adhesion. May play a role in cell-collagen interactions.
Tissue Specificity Highly expressed in the corneal epithelium . Expressed in heart, placenta, lung, liver, skeletal muscle, kidney and pancreas .
Reactome Pathway
Amyloid fiber formation (R-HSA-977225 )

Molecular Interaction Atlas (MIA) of This DOT

50 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Granular corneal dystrophy type I DISREWXU Definitive Autosomal dominant [1]
Granular corneal dystrophy type II DISAEE20 Definitive Autosomal dominant [2]
Lattice corneal dystrophy type I DISNKVHC Definitive Autosomal dominant [3]
Reis-Bucklers corneal dystrophy DIS5SQDR Definitive Autosomal dominant [1]
Thiel-Behnke corneal dystrophy DIS3GK26 Definitive Autosomal dominant [1]
Adenocarcinoma DIS3IHTY Strong Biomarker [4]
Astrocytoma DISL3V18 Strong Biomarker [5]
Bone osteosarcoma DIST1004 Strong Biomarker [6]
Breast cancer DIS7DPX1 Strong Biomarker [7]
Breast carcinoma DIS2UE88 Strong Biomarker [7]
Diabetic kidney disease DISJMWEY Strong Altered Expression [8]
Epithelial ovarian cancer DIS56MH2 Strong Altered Expression [9]
Esophageal squamous cell carcinoma DIS5N2GV Strong Altered Expression [10]
Fuchs' endothelial dystrophy DISL7TXC Strong Biomarker [11]
Gastric cancer DISXGOUK Strong Altered Expression [12]
Glioma DIS5RPEH Strong Biomarker [13]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [14]
Keratoconus DISOONXH Strong Genetic Variation [15]
leukaemia DISS7D1V Strong Altered Expression [16]
Leukemia DISNAKFL Strong Altered Expression [16]
Lung cancer DISCM4YA Strong Altered Expression [17]
Lung carcinoma DISTR26C Strong Altered Expression [17]
Lung neoplasm DISVARNB Strong Altered Expression [18]
Matthew-Wood syndrome DISA7HR7 Strong Biomarker [19]
Nasopharyngeal carcinoma DISAOTQ0 Strong Biomarker [13]
Nephropathy DISXWP4P Strong Biomarker [20]
Non-insulin dependent diabetes DISK1O5Z Strong Biomarker [21]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [22]
Osteoarthritis DIS05URM Strong Biomarker [23]
Osteosarcoma DISLQ7E2 Strong Biomarker [6]
Ovarian cancer DISZJHAP Strong Altered Expression [9]
Ovarian neoplasm DISEAFTY Strong Altered Expression [9]
Pancreatic cancer DISJC981 Strong Biomarker [24]
Renal cell carcinoma DISQZ2X8 Strong Altered Expression [25]
Squamous cell carcinoma DISQVIFL Strong Altered Expression [26]
Stomach cancer DISKIJSX Strong Altered Expression [12]
Systemic sclerosis DISF44L6 Strong Biomarker [27]
Transitional cell carcinoma DISWVVDR Strong Biomarker [28]
Urothelial carcinoma DISRTNTN Strong Biomarker [28]
Carcinoma DISH9F1N moderate Biomarker [29]
Metastatic malignant neoplasm DIS86UK6 moderate Biomarker [30]
Stroke DISX6UHX moderate Genetic Variation [31]
Epithelial basement membrane dystrophy DISTUHYE Supportive Autosomal dominant [32]
Advanced cancer DISAT1Z9 Disputed Biomarker [33]
Amyloidosis DISHTAI2 Limited Biomarker [34]
Cataract DISUD7SL Limited Biomarker [35]
Clear cell renal carcinoma DISBXRFJ Limited Altered Expression [25]
Colorectal carcinoma DIS5PYL0 Limited Biomarker [36]
Melanoma DIS1RRCY Limited Altered Expression [30]
Type-1 diabetes DIS7HLUB Limited Altered Expression [37]
------------------------------------------------------------------------------------
⏷ Show the Full List of 50 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 5 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Cisplatin DMRHGI9 Approved Transforming growth factor-beta-induced protein ig-h3 (TGFBI) decreases the response to substance of Cisplatin. [59]
Methotrexate DM2TEOL Approved Transforming growth factor-beta-induced protein ig-h3 (TGFBI) decreases the response to substance of Methotrexate. [59]
Fluorouracil DMUM7HZ Approved Transforming growth factor-beta-induced protein ig-h3 (TGFBI) affects the response to substance of Fluorouracil. [60]
Paclitaxel DMLB81S Approved Transforming growth factor-beta-induced protein ig-h3 (TGFBI) decreases the response to substance of Paclitaxel. [59]
Topotecan DMP6G8T Approved Transforming growth factor-beta-induced protein ig-h3 (TGFBI) decreases the response to substance of Topotecan. [59]
------------------------------------------------------------------------------------
20 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Transforming growth factor-beta-induced protein ig-h3 (TGFBI). [38]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Transforming growth factor-beta-induced protein ig-h3 (TGFBI). [39]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Transforming growth factor-beta-induced protein ig-h3 (TGFBI). [40]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Transforming growth factor-beta-induced protein ig-h3 (TGFBI). [41]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Transforming growth factor-beta-induced protein ig-h3 (TGFBI). [42]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Transforming growth factor-beta-induced protein ig-h3 (TGFBI). [43]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Transforming growth factor-beta-induced protein ig-h3 (TGFBI). [44]
Triclosan DMZUR4N Approved Triclosan increases the expression of Transforming growth factor-beta-induced protein ig-h3 (TGFBI). [46]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Transforming growth factor-beta-induced protein ig-h3 (TGFBI). [47]
Decitabine DMQL8XJ Approved Decitabine increases the expression of Transforming growth factor-beta-induced protein ig-h3 (TGFBI). [48]
Dexamethasone DMMWZET Approved Dexamethasone decreases the expression of Transforming growth factor-beta-induced protein ig-h3 (TGFBI). [49]
Irinotecan DMP6SC2 Approved Irinotecan decreases the expression of Transforming growth factor-beta-induced protein ig-h3 (TGFBI). [50]
Mitomycin DMH0ZJE Approved Mitomycin decreases the expression of Transforming growth factor-beta-induced protein ig-h3 (TGFBI). [51]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of Transforming growth factor-beta-induced protein ig-h3 (TGFBI). [52]
Tocopherol DMBIJZ6 Phase 2 Tocopherol increases the expression of Transforming growth factor-beta-induced protein ig-h3 (TGFBI). [53]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Transforming growth factor-beta-induced protein ig-h3 (TGFBI). [55]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Transforming growth factor-beta-induced protein ig-h3 (TGFBI). [56]
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the expression of Transforming growth factor-beta-induced protein ig-h3 (TGFBI). [57]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Transforming growth factor-beta-induced protein ig-h3 (TGFBI). [38]
chloropicrin DMSGBQA Investigative chloropicrin decreases the expression of Transforming growth factor-beta-induced protein ig-h3 (TGFBI). [58]
------------------------------------------------------------------------------------
⏷ Show the Full List of 20 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Transforming growth factor-beta-induced protein ig-h3 (TGFBI). [45]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Transforming growth factor-beta-induced protein ig-h3 (TGFBI). [54]
------------------------------------------------------------------------------------

References

1 BIGH3 mutation spectrum in corneal dystrophies. Invest Ophthalmol Vis Sci. 2002 Apr;43(4):949-54.
2 Homozygous granular corneal dystrophy type II (Avellino corneal dystrophy): natural history and progression after treatment. Cornea. 2007 Oct;26(9):1095-100. doi: 10.1097/ICO.0b013e3181484013.
3 Flexible and scalable diagnostic filtering of genomic variants using G2P with Ensembl VEP. Nat Commun. 2019 May 30;10(1):2373. doi: 10.1038/s41467-019-10016-3.
4 Role of RUNX2 transcription factor in epithelial mesenchymal transition in non-small cell lung cancer lung cancer: Epigenetic control of the RUNX2 P1 promoter.Tumour Biol. 2019 May;41(5):1010428319851014. doi: 10.1177/1010428319851014.
5 Transforming growth factor-beta-inducible gene-h3 (beta(ig)-h3) promotes cell adhesion of human astrocytoma cells in vitro: implication of alpha6beta4 integrin.Neurosci Lett. 2003 Jan 16;336(2):93-6. doi: 10.1016/s0304-3940(02)01260-0.
6 C-terminal fragment of transforming growth factor beta-induced protein (TGFBIp) is required for apoptosis in human osteosarcoma cells.Matrix Biol. 2009 Jul;28(6):347-53. doi: 10.1016/j.matbio.2009.05.004. Epub 2009 Jun 6.
7 Estrogen receptor--miR-1271-SNAI2 feedback loop regulates transforming growth factor--induced breast cancer progression.J Exp Clin Cancer Res. 2019 Mar 1;38(1):109. doi: 10.1186/s13046-019-1112-4.
8 Next-generation sequencing identifies TGF-1-associated gene expression profiles in renal epithelial cells reiterated in human diabetic nephropathy.Biochim Biophys Acta. 2012 Apr;1822(4):589-99. doi: 10.1016/j.bbadis.2012.01.008. Epub 2012 Jan 14.
9 ERRATUM.Oncol Res. 2017 Jan 2;25(1):155. doi: 10.3727/096504017X14811155525280.
10 TGFBI Expression in Cancer Stromal Cells is Associated with Poor Prognosis and Hematogenous Recurrence in Esophageal Squamous Cell Carcinoma.Ann Surg Oncol. 2016 Jan;23(1):282-9. doi: 10.1245/s10434-014-4259-4. Epub 2014 Dec 2.
11 The future of keratoplasty: cell-based therapy, regenerative medicine, bioengineering keratoplasty, gene therapy.Curr Opin Ophthalmol. 2019 Jul;30(4):286-291. doi: 10.1097/ICU.0000000000000573.
12 High stromaltransforming growth factor -induced expression is a novel marker of progression and poor prognosis in gastric cancer.J Surg Oncol. 2018 Nov;118(6):966-974. doi: 10.1002/jso.25217. Epub 2018 Sep 9.
13 Secreted TGF-beta-induced protein promotes aggressive progression in bladder cancer cells.Cancer Manag Res. 2019 Jul 25;11:6995-7006. doi: 10.2147/CMAR.S208984. eCollection 2019.
14 Downregulation of Epidermal Growth Factor Receptor in hepatocellular carcinoma facilitates Transforming Growth Factor--induced epithelial to amoeboid transition.Cancer Lett. 2019 Nov 1;464:15-24. doi: 10.1016/j.canlet.2019.08.011. Epub 2019 Aug 26.
15 Mutation analysis of TGFBI and KRT12 in a case of concomitant keratoconus and granular corneal dystrophy.Graefes Arch Clin Exp Ophthalmol. 2017 Sep;255(9):1779-1786. doi: 10.1007/s00417-017-3699-5. Epub 2017 May 31.
16 Epigenetic regulation of putative tumor suppressor TGFBI in human leukemias.Chin Med J (Engl). 2014;127(9):1645-50.
17 High Stromal TGFBI in Lung Cancer and Intratumoral CD8-Positive T Cells were Associated with Poor Prognosis and Therapeutic Resistance to Immune Checkpoint Inhibitors.Ann Surg Oncol. 2020 Mar;27(3):933-942. doi: 10.1245/s10434-019-07878-8. Epub 2019 Sep 30.
18 Epigenetic inactivation of Betaig-h3 gene in human cancer cells.Cancer Res. 2006 May 1;66(9):4566-73. doi: 10.1158/0008-5472.CAN-05-2130.
19 Transforming growth factor beta-induced, an extracellular matrix interacting protein, enhances glycolysis and promotes pancreatic cancer cell migration.Int J Cancer. 2019 Sep 15;145(6):1570-1584. doi: 10.1002/ijc.32247. Epub 2019 Mar 28.
20 Inhibitory effect of pravastatin on transforming growth factor beta1-inducible gene h3 expression in a rat model of chronic cyclosporine nephropathy.Am J Nephrol. 2005 Nov-Dec;25(6):611-20. doi: 10.1159/000089905. Epub 2005 Nov 22.
21 Associations of Four Community Factors With Longitudinal Change in Hemoglobin A(1c) Levels in Patients With Type 2 Diabetes.Diabetes Care. 2018 Mar;41(3):461-468. doi: 10.2337/dc17-1200. Epub 2017 Dec 19.
22 Transforming growth factor -induced epithelial-to-mesenchymal signature predicts metastasis-free survival in non-small cell lung cancer.Oncotarget. 2019 Jan 25;10(8):810-824. doi: 10.18632/oncotarget.26574. eCollection 2019 Jan 25.
23 TGFBI secreted by mesenchymal stromal cells ameliorates osteoarthritis and is detected in extracellular vesicles.Biomaterials. 2020 Jan;226:119544. doi: 10.1016/j.biomaterials.2019.119544. Epub 2019 Oct 11.
24 Stromal protein ig-h3 reprogrammes tumour microenvironment in pancreatic cancer.Gut. 2019 Apr;68(4):693-707. doi: 10.1136/gutjnl-2018-317570. Epub 2018 Nov 10.
25 VHL-TGFBI signaling is involved in the synergy between 5-aza-2'-deoxycytidine and paclitaxel against human renal cell carcinoma.J BUON. 2017 Jul-Aug;22(4):1038-1045.
26 TGFBI Promotes Tumor Growth and is Associated with Poor Prognosis in Oral Squamous Cell Carcinoma.J Cancer. 2019 Aug 27;10(20):4902-4912. doi: 10.7150/jca.29958. eCollection 2019.
27 Suppressive Regulation by MFG-E8 of Latent Transforming Growth Factor -Induced Fibrosis via Binding to v Integrin: Significance in the Pathogenesis of Fibrosis in Systemic Sclerosis.Arthritis Rheumatol. 2019 Feb;71(2):302-314. doi: 10.1002/art.40701. Epub 2019 Jan 4.
28 TGFBI Protein Is Increased in the Urine of Patients with High-Grade Urothelial Carcinomas, and Promotes Cell Proliferation and Migration.Int J Mol Sci. 2019 Sep 11;20(18):4483. doi: 10.3390/ijms20184483.
29 Epirubicin suppresses proliferative and metastatic potential by downregulating transforming growth factor--induced expression in urothelial carcinoma.Cancer Sci. 2018 Apr;109(4):980-987. doi: 10.1111/cas.13403. Epub 2018 Feb 20.
30 Transforming growth factor beta-induced (TGFBI) is an anti-adhesive protein regulating the invasive growth of melanoma cells.Am J Pathol. 2012 Apr;180(4):1663-74. doi: 10.1016/j.ajpath.2011.12.035. Epub 2012 Feb 9.
31 Meta-Analysis of Genome-Wide Association Studies Identifies Genetic Risk Factors for Stroke in African Americans.Stroke. 2015 Aug;46(8):2063-8. doi: 10.1161/STROKEAHA.115.009044. Epub 2015 Jun 18.
32 A subset of patients with epithelial basement membrane corneal dystrophy have mutations in TGFBI/BIGH3. Hum Mutat. 2006 Jun;27(6):553-7. doi: 10.1002/humu.20331.
33 Hypoxia-Induced TGFBI as a Serum Biomarker for Laboratory Diagnosis and Prognosis in Patients with Pancreatic Ductal Adenocarcinoma.Lab Med. 2020 Jul 8;51(4):352-361. doi: 10.1093/labmed/lmz063.
34 The serine protease HtrA1 cleaves misfolded transforming growth factor -induced protein (TGFBIp) and induces amyloid formation.J Biol Chem. 2019 Aug 2;294(31):11817-11828. doi: 10.1074/jbc.RA119.009050. Epub 2019 Jun 13.
35 Downregulated expression of ADAM9 in anterior polar cataracts.J Cataract Refract Surg. 2002 Apr;28(4):697-702. doi: 10.1016/s0886-3350(01)01236-6.
36 Epigenetic profiling and mRNA expression reveal candidate genes as biomarkers for colorectal cancer.J Cell Biochem. 2019 Jun;120(6):10767-10776. doi: 10.1002/jcb.28368. Epub 2019 Jan 22.
37 ig-h3 Represses T-Cell Activation in Type 1 Diabetes.Diabetes. 2015 Dec;64(12):4212-9. doi: 10.2337/db15-0638. Epub 2015 Oct 15.
38 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
39 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
40 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
41 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
42 RNA sequence analysis of inducible pluripotent stem cell-derived cardiomyocytes reveals altered expression of DNA damage and cell cycle genes in response to doxorubicin. Toxicol Appl Pharmacol. 2018 Oct 1;356:44-53.
43 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
44 Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
45 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
46 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
47 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
48 Characterization of DOK1, a candidate tumor suppressor gene, in epithelial ovarian cancer. Mol Oncol. 2011 Oct;5(5):438-53. doi: 10.1016/j.molonc.2011.07.003. Epub 2011 Jul 26.
49 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
50 Clinical determinants of response to irinotecan-based therapy derived from cell line models. Clin Cancer Res. 2008 Oct 15;14(20):6647-55.
51 Mitomycin C induces apoptosis in cultured corneal fibroblasts derived from type II granular corneal dystrophy corneas. Mol Vis. 2008 Jun 30;14:1222-8.
52 A novel long noncoding RNA AK001796 acts as an oncogene and is involved in cell growth inhibition by resveratrol in lung cancer. Toxicol Appl Pharmacol. 2015 Jun 1;285(2):79-88.
53 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
54 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
55 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
56 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
57 Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
58 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
59 Microarray-based detection and expression analysis of extracellular matrix proteins in drug?resistant ovarian cancer cell lines. Oncol Rep. 2014 Nov;32(5):1981-90. doi: 10.3892/or.2014.3468. Epub 2014 Sep 9.
60 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.