Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRBGH71)

DOT Name Golgi-associated PDZ and coiled-coil motif-containing protein (GOPC)
Synonyms CFTR-associated ligand; Fused in glioblastoma; PDZ protein interacting specifically with TC10; PIST
Gene Name GOPC
Related Disease
Nephropathy ( )
Thyroid gland carcinoma ( )
Thyroid tumor ( )
Type-1/2 diabetes ( )
Acute lymphocytic leukaemia ( )
Adult glioblastoma ( )
Advanced cancer ( )
B-cell neoplasm ( )
Breast cancer ( )
Breast carcinoma ( )
Childhood acute lymphoblastic leukemia ( )
Colorectal carcinoma ( )
Cystic fibrosis ( )
Epilepsy ( )
Glioblastoma multiforme ( )
Glioma ( )
Head-neck squamous cell carcinoma ( )
Hepatocellular carcinoma ( )
Lung adenocarcinoma ( )
Lung cancer ( )
Lung carcinoma ( )
Malignant glioma ( )
Mantle cell lymphoma ( )
Melanoma ( )
Metastatic malignant neoplasm ( )
Movement disorder ( )
Neoplasm ( )
Non-hodgkin lymphoma ( )
Non-insulin dependent diabetes ( )
Oral cancer ( )
Osteosarcoma ( )
Plasma cell myeloma ( )
Thyroid cancer ( )
Thyroid gland undifferentiated (anaplastic) carcinoma ( )
Triple negative breast cancer ( )
Familial atrial fibrillation ( )
Small lymphocytic lymphoma ( )
Bone osteosarcoma ( )
Atrial fibrillation ( )
Gallbladder carcinoma ( )
leukaemia ( )
Leukemia ( )
Squamous cell carcinoma ( )
Tourette syndrome ( )
UniProt ID
GOPC_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2DC2 ; 2LOB ; 4E34 ; 4E35 ; 4JOE ; 4JOF ; 4JOG ; 4JOH ; 4JOJ ; 4JOK ; 4JOP ; 4JOR ; 4K6Y ; 4K72 ; 4K75 ; 4K76 ; 4K78 ; 4NMO ; 4NMP ; 4NMQ ; 4NMR ; 4NMS ; 4NMT ; 4NMV ; 4Q6H ; 4Q6S ; 5IC3 ; 5K4F ; 6OV7 ; 6V84 ; 6XNJ ; 7JZO ; 7JZP ; 7JZQ ; 7JZR
Pfam ID
PF00595
Sequence
MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQA
DITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVDLKSELTETQAEKVVLEKEVH
DQLLQLHSIQLQLHAKTGQSADSGTIKAKLSGPSVEELERELEANKKEKMKEAQLEAEVK
LLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQL
EAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLG
ISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQR
GEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQG
FNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY
Function
Plays a role in intracellular protein trafficking and degradation. May regulate CFTR chloride currents and acid-induced ASIC3 currents by modulating cell surface expression of both channels. May also regulate the intracellular trafficking of the ADR1B receptor. May play a role in autophagy. Together with MARCHF2 mediates the ubiquitination and lysosomal degradation of CFTR. Overexpression results in CFTR intracellular retention and lysosomaldegradation in the lysosomes.
Tissue Specificity Ubiquitously expressed.
Reactome Pathway
RHOQ GTPase cycle (R-HSA-9013406 )
RHO GTPases regulate CFTR trafficking (R-HSA-5627083 )

Molecular Interaction Atlas (MIA) of This DOT

44 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Nephropathy DISXWP4P Definitive Biomarker [1]
Thyroid gland carcinoma DISMNGZ0 Definitive Altered Expression [2]
Thyroid tumor DISLVKMD Definitive Altered Expression [2]
Type-1/2 diabetes DISIUHAP Definitive Genetic Variation [3]
Acute lymphocytic leukaemia DISPX75S Strong Biomarker [4]
Adult glioblastoma DISVP4LU Strong Biomarker [5]
Advanced cancer DISAT1Z9 Strong Biomarker [6]
B-cell neoplasm DISVY326 Strong Altered Expression [7]
Breast cancer DIS7DPX1 Strong Genetic Variation [8]
Breast carcinoma DIS2UE88 Strong Genetic Variation [8]
Childhood acute lymphoblastic leukemia DISJ5D6U Strong Biomarker [4]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [9]
Cystic fibrosis DIS2OK1Q Strong Genetic Variation [10]
Epilepsy DISBB28L Strong Biomarker [11]
Glioblastoma multiforme DISK8246 Strong Biomarker [5]
Glioma DIS5RPEH Strong Genetic Variation [5]
Head-neck squamous cell carcinoma DISF7P24 Strong Biomarker [12]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [13]
Lung adenocarcinoma DISD51WR Strong Biomarker [14]
Lung cancer DISCM4YA Strong Genetic Variation [14]
Lung carcinoma DISTR26C Strong Genetic Variation [14]
Malignant glioma DISFXKOV Strong Genetic Variation [15]
Mantle cell lymphoma DISFREOV Strong Altered Expression [16]
Melanoma DIS1RRCY Strong Biomarker [17]
Metastatic malignant neoplasm DIS86UK6 Strong Biomarker [18]
Movement disorder DISOJJ2D Strong Genetic Variation [19]
Neoplasm DISZKGEW Strong Biomarker [5]
Non-hodgkin lymphoma DISS2Y8A Strong Biomarker [20]
Non-insulin dependent diabetes DISK1O5Z Strong Biomarker [21]
Oral cancer DISLD42D Strong Biomarker [22]
Osteosarcoma DISLQ7E2 Strong Biomarker [23]
Plasma cell myeloma DIS0DFZ0 Strong Biomarker [24]
Thyroid cancer DIS3VLDH Strong Altered Expression [2]
Thyroid gland undifferentiated (anaplastic) carcinoma DISYBB1W Strong Biomarker [25]
Triple negative breast cancer DISAMG6N Strong Biomarker [26]
Familial atrial fibrillation DISL4AGF moderate Biomarker [27]
Small lymphocytic lymphoma DIS30POX moderate Biomarker [28]
Bone osteosarcoma DIST1004 Disputed Biomarker [23]
Atrial fibrillation DIS15W6U Limited Biomarker [27]
Gallbladder carcinoma DISD6ACL Limited Genetic Variation [29]
leukaemia DISS7D1V Limited Biomarker [30]
Leukemia DISNAKFL Limited Biomarker [30]
Squamous cell carcinoma DISQVIFL Limited Biomarker [31]
Tourette syndrome DISX9D54 No Known Unknown [32]
------------------------------------------------------------------------------------
⏷ Show the Full List of 44 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Golgi-associated PDZ and coiled-coil motif-containing protein (GOPC). [33]
Doxorubicin DMVP5YE Approved Doxorubicin affects the expression of Golgi-associated PDZ and coiled-coil motif-containing protein (GOPC). [34]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Golgi-associated PDZ and coiled-coil motif-containing protein (GOPC). [35]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Golgi-associated PDZ and coiled-coil motif-containing protein (GOPC). [36]
Ivermectin DMDBX5F Approved Ivermectin increases the expression of Golgi-associated PDZ and coiled-coil motif-containing protein (GOPC). [37]
Menadione DMSJDTY Approved Menadione affects the expression of Golgi-associated PDZ and coiled-coil motif-containing protein (GOPC). [38]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol decreases the expression of Golgi-associated PDZ and coiled-coil motif-containing protein (GOPC). [39]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Golgi-associated PDZ and coiled-coil motif-containing protein (GOPC). [41]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Golgi-associated PDZ and coiled-coil motif-containing protein (GOPC). [43]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Golgi-associated PDZ and coiled-coil motif-containing protein (GOPC). [44]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
TAK-243 DM4GKV2 Phase 1 TAK-243 increases the sumoylation of Golgi-associated PDZ and coiled-coil motif-containing protein (GOPC). [40]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 increases the phosphorylation of Golgi-associated PDZ and coiled-coil motif-containing protein (GOPC). [42]
------------------------------------------------------------------------------------

References

1 Molecular analysis of SV-40-CAL, a new slow growing SV-40 strain from the kidney of a caged New World monkey with fatal renal disease.Virus Genes. 2004 Oct;29(2):183-90. doi: 10.1023/B:VIRU.0000036378.42136.7c.
2 Long non-coding RNA BANCR regulates cancer stem cell markers in papillary thyroid cancer via the RAF/MEK/ERK signaling pathway.Oncol Rep. 2018 Aug;40(2):859-866. doi: 10.3892/or.2018.6502. Epub 2018 Jun 18.
3 Diabetic bone lesions: a study on 38 known modern skeletons and the implications for forensic scenarios.Int J Legal Med. 2019 Jul;133(4):1225-1239. doi: 10.1007/s00414-018-1870-0. Epub 2018 Jun 2.
4 PI3K- inhibition using CAL-101 exerts apoptotic effects and increases doxorubicin-induced cell death in pre-B-acute lymphoblastic leukemia cells.Anticancer Drugs. 2017 Apr;28(4):436-445. doi: 10.1097/CAD.0000000000000477.
5 GOPC-ROS1 Fusion Due to Microdeletion at 6q22 Is an Oncogenic Driver in a Subset of Pediatric Gliomas and Glioneuronal Tumors.J Neuropathol Exp Neurol. 2019 Dec 1;78(12):1089-1099. doi: 10.1093/jnen/nlz093.
6 Inhibition of Cancer Stem-Like Phenotype by Curcumin and Deguelin in CAL-62 Anaplastic Thyroid Cancer Cells.Anticancer Agents Med Chem. 2019;19(15):1887-1898. doi: 10.2174/1871520619666191004144025.
7 PI3K activates E2F1 synthesis in response to mRNA translation stress.Nat Commun. 2017 Dec 13;8(1):2103. doi: 10.1038/s41467-017-02282-w.
8 The appearance of breast cancer metastases on dry bone: Implications for forensic anthropology.J Forensic Leg Med. 2019 Feb;61:5-12. doi: 10.1016/j.jflm.2018.10.007. Epub 2018 Oct 25.
9 The effect of age on anastomotic leakage in colorectal cancer surgery: A population-based study.J Surg Oncol. 2018 Jul;118(1):113-120. doi: 10.1002/jso.25108. Epub 2018 Jun 7.
10 Cysteine modifiers suggest an allosteric inhibitory site on the CAL PDZ domain.Biosci Rep. 2018 Jul 6;38(4):BSR20180231. doi: 10.1042/BSR20180231. Print 2018 Aug 31.
11 Valproic acid, a histone deacetylase inhibitor, enhances sensitivity to doxorubicin in anaplastic thyroid cancer cells.J Endocrinol. 2006 Nov;191(2):465-72. doi: 10.1677/joe.1.06970.
12 Gold nanoclusters as a contrast agent for image-guided surgery of head and neck tumors.Nanomedicine. 2019 Aug;20:102011. doi: 10.1016/j.nano.2019.04.014. Epub 2019 May 17.
13 PEGylated doxorubicin nanoparticles mediated by HN-1 peptide for targeted treatment of oral squamous cell carcinoma.Int J Pharm. 2017 Jun 15;525(1):21-31. doi: 10.1016/j.ijpharm.2017.04.027. Epub 2017 Apr 12.
14 Identification of KIF5B-RET and GOPC-ROS1 fusions in lung adenocarcinomas through a comprehensive mRNA-based screen for tyrosine kinase fusions.Clin Cancer Res. 2012 Dec 15;18(24):6599-608. doi: 10.1158/1078-0432.CCR-12-0838. Epub 2012 Oct 10.
15 Novel GOPC(FIG)-ROS1 fusion in a pediatric high-grade glioma survivor.J Neurosurg Pediatr. 2017 Jul;20(1):51-55. doi: 10.3171/2017.2.PEDS16679. Epub 2017 Apr 7.
16 Mantle cell lymphoma: 2012 update on diagnosis, risk-stratification, and clinical management.Am J Hematol. 2012 Jun;87(6):604-9. doi: 10.1002/ajh.23176.
17 Aggressiveness of human melanoma xenograft models is promoted by aneuploidy-driven gene expression deregulation.Oncotarget. 2012 Apr;3(4):399-413. doi: 10.18632/oncotarget.473.
18 Human breast-cancer metastasis formation in a nude-mouse model: studies of hyaluronidase, hyaluronan and hyaluronan-binding sites in metastatic cells.Int J Cancer. 1999 Jul 2;82(1):77-83. doi: 10.1002/(sici)1097-0215(19990702)82:1<77::aid-ijc14>3.0.co;2-q.
19 Genotype-phenotype correlation in interstitial 6q deletions: a report of 12 new cases.Neurogenetics. 2012 Feb;13(1):31-47. doi: 10.1007/s10048-011-0306-5. Epub 2012 Jan 5.
20 Combining CAL-101 with Celecoxib Enhances Apoptosis of EBV-transformed B-Cells Through MAPK-induced ER Stress.Anticancer Res. 2015 May;35(5):2699-708.
21 Upregulation of proteins of the NLRP3 inflammasome in patients with periodontitis and uncontrolled type 2 diabetes.Oral Dis. 2019 Mar;25(2):596-608. doi: 10.1111/odi.13003. Epub 2018 Dec 16.
22 Suppression of the TNF-alpha level is mediated by Gan-Lu-Yin (traditional Chinese medicine) in human oral cancer cells through the NF-kappa B, AKT, and ERK-dependent pathways.Environ Toxicol. 2016 Oct;31(10):1196-205. doi: 10.1002/tox.22127. Epub 2015 Feb 26.
23 A Novel Fluorescence-Labeled Curcumin Conjugate: Synthesis, Evaluation and Imaging on Human Cell Lines.Curr Pharm Des. 2018;24(16):1821-1826. doi: 10.2174/1381612824666180406103317.
24 PI3K/p110{delta} is a novel therapeutic target in multiple myeloma.Blood. 2010 Sep 2;116(9):1460-8. doi: 10.1182/blood-2009-06-222943. Epub 2010 May 26.
25 Anti-hTERT siRNA-Loaded Nanoparticles Block the Growth of Anaplastic Thyroid Cancer Xenograft.Mol Cancer Ther. 2018 Jun;17(6):1187-1195. doi: 10.1158/1535-7163.MCT-17-0559. Epub 2018 Mar 21.
26 The Chk1 inhibitor MK-8776 increases the radiosensitivity of human triple-negative breast cancer by inhibiting autophagy.Acta Pharmacol Sin. 2017 Apr;38(4):513-523. doi: 10.1038/aps.2016.136. Epub 2017 Jan 2.
27 Multi-ethnic genome-wide association study for atrial fibrillation.Nat Genet. 2018 Jun 11;50(9):1225-1233. doi: 10.1038/s41588-018-0133-9.
28 The role of phosphatidylinositol 3-kinase- in the immunomodulatory effects of lenalidomide in chronic lymphocytic leukemia.Blood. 2011 Apr 21;117(16):4323-7. doi: 10.1182/blood-2010-11-315705. Epub 2011 Mar 4.
29 Screening for the FIG-ROS1 fusion in biliary tract carcinomas by nested PCR.Genes Chromosomes Cancer. 2014 Dec;53(12):1033-40. doi: 10.1002/gcc.22212. Epub 2014 Sep 18.
30 Synergistic Effects of PI3K and c-Myc Co-targeting in Acute Leukemia: Shedding New Light on Resistance to Selective PI3K- Inhibitor CAL-101.Cancer Invest. 2019;37(7):311-324. doi: 10.1080/07357907.2019.1651328. Epub 2019 Aug 14.
31 Quantitative Analysis of [(18)F]FMISO PET for Tumor Hypoxia: Correlation of Modeling Results with Immunohistochemistry.Mol Imaging Biol. 2017 Feb;19(1):120-129. doi: 10.1007/s11307-016-0975-4.
32 The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
33 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
34 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
35 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
36 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
37 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
38 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
39 Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
40 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
41 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
42 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
43 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
44 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.