Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSLSPZG)

DOT Name	Low affinity immunoglobulin gamma Fc region receptor III-B (FCGR3B)
Synonyms	Fc-gamma RIII-beta; CD16-I; Fc-gamma RIII; Fc-gamma RIIIb; FcRIII; FcRIIIb; FcR-10; IgG Fc receptor III-1; CD antigen CD16b
Gene Name	FCGR3B
Related Disease	Acute myelogenous leukaemia ( ) Advanced cancer ( ) Allergic contact dermatitis ( ) Alzheimer disease ( ) Ankylosing spondylitis ( ) Breast cancer ( ) Breast carcinoma ( ) Chronic hepatitis B virus infection ( ) Chronic kidney disease ( ) Chronic renal failure ( ) Classic Hodgkin lymphoma ( ) Clear cell renal carcinoma ( ) Coronary atherosclerosis ( ) Coronary heart disease ( ) Glomerulonephritis ( ) Hepatitis C virus infection ( ) Hepatocellular carcinoma ( ) leukaemia ( ) Lupus ( ) Malaria ( ) Multiple sclerosis ( ) Myelodysplastic syndrome ( ) Neoplasm ( ) Non-insulin dependent diabetes ( ) Obesity ( ) Osteoarthritis ( ) Psoriasis ( ) Renal cell carcinoma ( ) Sarcoidosis ( ) Small lymphocytic lymphoma ( ) Tuberculosis ( ) Ulcerative colitis ( ) Cardiovascular disease ( ) Crohn disease ( ) IgA nephropathy ( ) Inflammatory bowel disease ( ) Type-1 diabetes ( ) Arteriosclerosis ( ) Atherosclerosis ( ) Colorectal carcinoma ( ) Hyperglycemia ( ) Hyperinsulinemia ( ) Leukemia ( ) Pancreatic cancer ( ) Paroxysmal nocturnal haemoglobinuria ( ) Plasma cell myeloma ( )
UniProt ID	FCG3B_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	1E4J; 1E4K; 1FNL; 1T83; 1T89; 6EAQ
Pfam ID	PF13895
Sequence	MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQW FHNENLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKE EDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKN VSSETVNITITQGLAVSTISSFSPPGYQVSFCLVMVLLFAVDTGLYFSVKTNI
Function	Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
Tissue Specificity	Expressed specifically by polymorphonuclear leukocytes (neutrophils). Also expressed by stimulated eosinophils.
KEGG Pathway	Phagosome (hsa04145 ) Osteoclast differentiation (hsa04380 ) Neutrophil extracellular trap formation (hsa04613 ) .tural killer cell mediated cytotoxicity (hsa04650 ) Fc gamma R-mediated phagocytosis (hsa04666 ) Leishmaniasis (hsa05140 ) Staphylococcus aureus infection (hsa05150 ) Tuberculosis (hsa05152 ) Systemic lupus erythematosus (hsa05322 )
Reactome Pathway	Neutrophil degranulation (R-HSA-6798695 ) Post-translational modification (R-HSA-163125 )

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Allergic contact dermatitis	DISFFVF9	Strong	Biomarker	[3]
Alzheimer disease	DISF8S70	Strong	Biomarker	[4]
Ankylosing spondylitis	DISRC6IR	Strong	Biomarker	[5]
Breast cancer	DIS7DPX1	Strong	Biomarker	[6]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[7]
Chronic hepatitis B virus infection	DISHL4NT	Strong	Biomarker	[8]
Chronic kidney disease	DISW82R7	Strong	Biomarker	[9]
Chronic renal failure	DISGG7K6	Strong	Altered Expression	[10]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Biomarker	[9]
Clear cell renal carcinoma	DISBXRFJ	Strong	Altered Expression	[11]
Coronary atherosclerosis	DISKNDYU	Strong	Biomarker	[12]
Coronary heart disease	DIS5OIP1	Strong	Biomarker	[13]
Glomerulonephritis	DISPZIQ3	Strong	Biomarker	[14]
Hepatitis C virus infection	DISQ0M8R	Strong	Altered Expression	[15]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[16]
leukaemia	DISS7D1V	Strong	Altered Expression	[17]
Lupus	DISOKJWA	Strong	Biomarker	[18]
Malaria	DISQ9Y50	Strong	Altered Expression	[19]
Multiple sclerosis	DISB2WZI	Strong	Altered Expression	[20]
Myelodysplastic syndrome	DISYHNUI	Strong	Biomarker	[21]
Neoplasm	DISZKGEW	Strong	Biomarker	[22]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Altered Expression	[23]
Obesity	DIS47Y1K	Strong	Biomarker	[24]
Osteoarthritis	DIS05URM	Strong	Biomarker	[25]
Psoriasis	DIS59VMN	Strong	Biomarker	[26]
Renal cell carcinoma	DISQZ2X8	Strong	Altered Expression	[11]
Sarcoidosis	DISE5B8Z	Strong	Biomarker	[27]
Small lymphocytic lymphoma	DIS30POX	Strong	Biomarker	[28]
Tuberculosis	DIS2YIMD	Strong	Altered Expression	[29]
Ulcerative colitis	DIS8K27O	Strong	Genetic Variation	[30]
Cardiovascular disease	DIS2IQDX	moderate	Biomarker	[31]
Crohn disease	DIS2C5Q8	moderate	Biomarker	[32]
IgA nephropathy	DISZ8MTK	moderate	Biomarker	[33]
Inflammatory bowel disease	DISGN23E	moderate	Biomarker	[32]
Type-1 diabetes	DIS7HLUB	moderate	Biomarker	[34]
Arteriosclerosis	DISK5QGC	Limited	Biomarker	[31]
Atherosclerosis	DISMN9J3	Limited	Biomarker	[31]
Colorectal carcinoma	DIS5PYL0	Limited	Biomarker	[35]
Hyperglycemia	DIS0BZB5	Limited	Biomarker	[24]
Hyperinsulinemia	DISIDWT6	Limited	Biomarker	[24]
Leukemia	DISNAKFL	Limited	Biomarker	[36]
Pancreatic cancer	DISJC981	Limited	Genetic Variation	[37]
Paroxysmal nocturnal haemoglobinuria	DISBHMYH	Limited	Biomarker	[38]
Plasma cell myeloma	DIS0DFZ0	Limited	Biomarker	[39]
------------------------------------------------------------------------------------


⏷ Show the Full List of 46 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Beta-D-Glucose	DM5IHYP	Investigative	Low affinity immunoglobulin gamma Fc region receptor III-B (FCGR3B) decreases the response to substance of Beta-D-Glucose.	[44]
------------------------------------------------------------------------------------

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Low affinity immunoglobulin gamma Fc region receptor III-B (FCGR3B).	[40]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Low affinity immunoglobulin gamma Fc region receptor III-B (FCGR3B).	[41]
Coprexa	DMA0WEK	Phase 3	Coprexa increases the expression of Low affinity immunoglobulin gamma Fc region receptor III-B (FCGR3B).	[42]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Low affinity immunoglobulin gamma Fc region receptor III-B (FCGR3B).	[43]
------------------------------------------------------------------------------------

References

1	Bispecific NKG2D-CD3 and NKG2D-CD16 fusion proteins for induction of NK and T cell reactivity against acute myeloid leukemia.J Immunother Cancer. 2019 May 29;7(1):143. doi: 10.1186/s40425-019-0606-0.
2	Identification of anti-CD16a single domain antibodies and their application in bispecific antibodies.Cancer Biol Ther. 2020;21(1):72-80. doi: 10.1080/15384047.2019.1665953. Epub 2019 Sep 29.
3	Gene transcripts as potential diagnostic markers for allergic contact dermatitis.Contact Dermatitis. 2005 Aug;53(2):100-6. doi: 10.1111/j.0105-1873.2005.00658.x.
4	Systemic infection modifies the neuroinflammatory response in late stage Alzheimer's disease.Acta Neuropathol Commun. 2018 Sep 7;6(1):88. doi: 10.1186/s40478-018-0592-3.
5	TNF- Inhibitors Decrease Classical CD14(hi)CD16- Monocyte Subsets in Highly Active, Conventional Treatment Refractory Rheumatoid Arthritis and Ankylosing Spondylitis.Int J Mol Sci. 2019 Jan 12;20(2):291. doi: 10.3390/ijms20020291.
6	Peripheral blood NK cells from breast cancer patients are tumor-induced composite subsets.J Immunol. 2013 Mar 1;190(5):2424-36. doi: 10.4049/jimmunol.1200140. Epub 2013 Jan 28.
7	Elements related to heterogeneity of antibody-dependent cell cytotoxicity in patients under trastuzumab therapy for primary operable breast cancer overexpressing Her2.Cancer Res. 2007 Dec 15;67(24):11991-9. doi: 10.1158/0008-5472.CAN-07-2068.
8	NK-cell responses are biased towards CD16-mediated effector functions in chronic hepatitis B virus infection.J Hepatol. 2019 Mar;70(3):351-360. doi: 10.1016/j.jhep.2018.10.006. Epub 2018 Oct 18.
9	Inflammation induces osteoclast differentiation from peripheral mononuclear cells in chronic kidney disease patients: crosstalk between the immune and bone systems.Nephrol Dial Transplant. 2018 Jan 1;33(1):65-75. doi: 10.1093/ndt/gfx222.
10	Could there be Haemodynamic Stress Effects on Pro-Inflammatory CD14+CD16+ Monocytes during Convective-Diffusive Treatments? A Prospective Randomized Controlled Trial.Blood Purif. 2019;47(4):385-394. doi: 10.1159/000494711. Epub 2019 Jan 2.
11	Cytotoxic markers and frequency predict functional capacity of natural killer cells infiltrating renal cell carcinoma.Clin Cancer Res. 2006 Feb 1;12(3 Pt 1):718-25. doi: 10.1158/1078-0432.CCR-05-0857.
12	Reduction in CD16/CD56 and CD16/CD3/CD56 Natural Killer Cells in Coronary Artery Disease.Immunol Invest. 2017 Jul;46(5):526-535. doi: 10.1080/08820139.2017.1306866. Epub 2017 Apr 17.
13	Impact of Mon2 monocyte-platelet aggregates on human coronary artery disease.Eur J Clin Invest. 2018 May;48(5):e12911. doi: 10.1111/eci.12911. Epub 2018 Mar 7.
14	Urinary levels of the leukocyte surface molecule CD11b associate with glomerular inflammation in lupus nephritis.Kidney Int. 2019 Mar;95(3):680-692. doi: 10.1016/j.kint.2018.10.025. Epub 2019 Jan 31.
15	Hepatitis C virus-induced NK cell activation causes metzincin-mediated CD16 cleavage and impaired antibody-dependent cytotoxicity.J Hepatol. 2017 Jun;66(6):1130-1137. doi: 10.1016/j.jhep.2017.01.032. Epub 2017 Feb 10.
16	Combining expression of GPC3 in tumors and CD16 on NK cells from peripheral blood to identify patients responding to codrituzumab.Oncotarget. 2018 Jan 2;9(12):10436-10444. doi: 10.18632/oncotarget.23830. eCollection 2018 Feb 13.
17	Bufalin Enhances Immune Responses in Leukemic Mice Through Enhancing Phagocytosis of Macrophage In Vivo.In Vivo. 2018 Sep-Oct;32(5):1129-1136. doi: 10.21873/invivo.11355.
18	The role of neutrophils in skin damage induced by tissue-deposited lupus IgG.Immunology. 2018 Feb 16;154(4):604-12. doi: 10.1111/imm.12908. Online ahead of print.
19	Plasmodium falciparum Activates CD16+ Dendritic Cells to Produce Tumor Necrosis Factor and Interleukin-10 in Subpatent Malaria.J Infect Dis. 2019 Jan 29;219(4):660-671. doi: 10.1093/infdis/jiy555.
20	Selective upregulation of scavenger receptors in and around demyelinating areas in multiple sclerosis.J Neuropathol Exp Neurol. 2013 Feb;72(2):106-18. doi: 10.1097/NEN.0b013e31827fd9e8.
21	161533 TriKE stimulates NK-cell function to overcome myeloid-derived suppressor cells in MDS.Blood Adv. 2018 Jun 26;2(12):1459-1469. doi: 10.1182/bloodadvances.2017012369.
22	Novel Bispecific Aptamer Enhances Immune Cytotoxicity Against MUC1-Positive Tumor Cells by MUC1-CD16 Dual Targeting.Molecules. 2019 Jan 29;24(3):478. doi: 10.3390/molecules24030478.
23	Differential Expression of Human Peripheral Mononuclear Cells Phenotype Markers in Type 2 Diabetic Patients and Type 2 Diabetic Patients on Metformin.Front Endocrinol (Lausanne). 2018 Oct 9;9:537. doi: 10.3389/fendo.2018.00537. eCollection 2018.
24	Expression of macrophage genes within skeletal muscle correlates inversely with adiposity and insulin resistance in humans.Appl Physiol Nutr Metab. 2018 Feb;43(2):187-193. doi: 10.1139/apnm-2017-0228. Epub 2017 Oct 16.
25	Modified ZIF-8 Nanoparticles Attenuate Osteoarthritis by Reprogramming the Metabolic Pathway of Synovial Macrophages.ACS Appl Mater Interfaces. 2020 Jan 15;12(2):2009-2022. doi: 10.1021/acsami.9b16327. Epub 2019 Dec 31.
26	Chronic Psoriatic Skin Inflammation Leads to Increased Monocyte Adhesion and Aggregation.J Immunol. 2015 Sep 1;195(5):2006-18. doi: 10.4049/jimmunol.1402307. Epub 2015 Jul 29.
27	Copy number variation of FCGR genes in etiopathogenesis of sarcoidosis.PLoS One. 2017 May 4;12(5):e0177194. doi: 10.1371/journal.pone.0177194. eCollection 2017.
28	Circulating classical CD14++CD16- monocytes predict shorter time to initial treatment in chronic lymphocytic leukemiapatients: Differential effects of immune chemotherapy on monocyte-related membrane and soluble forms of CD163.Oncol Rep. 2015 Sep;34(3):1269-78. doi: 10.3892/or.2015.4088. Epub 2015 Jun 26.
29	Mycobacterium tuberculosis Drives Expansion of Low-Density Neutrophils Equipped With Regulatory Activities.Front Immunol. 2019 Nov 27;10:2761. doi: 10.3389/fimmu.2019.02761. eCollection 2019.
30	Impact of allele copy number of polymorphisms in FCGR3A and FCGR3B genes on susceptibility to ulcerative colitis.Inflamm Bowel Dis. 2013 Sep;19(10):2061-8. doi: 10.1097/MIB.0b013e318298118e.
31	Proportions of Proinflammatory Monocytes Are Important Predictors of Mortality Risk in Hemodialysis Patients.Mediators Inflamm. 2017;2017:1070959. doi: 10.1155/2017/1070959. Epub 2017 Oct 22.
32	CD16+ Macrophages Mediate Fibrosis in Inflammatory Bowel Disease.J Crohns Colitis. 2018 Apr 27;12(5):589-599. doi: 10.1093/ecco-jcc/jjx185.
33	Elevated Numbers of Circulating Very Small Embryonic-Like Stem Cells (VSELs) and Intermediate CD14++CD16+ Monocytes in IgA Nephropathy.Stem Cell Rev Rep. 2018 Oct;14(5):686-693. doi: 10.1007/s12015-018-9840-y.
34	Type 1 diabetic mellitus patients with increased atherosclerosis risk display decreased CDKN2A/2B/2BAS gene expression in leukocytes.J Transl Med. 2019 Jul 12;17(1):222. doi: 10.1186/s12967-019-1977-1.
35	In vitro elimination of epidermal growth factor receptor-overexpressing cancer cells by CD32A-chimeric receptor T cells in combination with cetuximab or panitumumab.Int J Cancer. 2020 Jan 1;146(1):236-247. doi: 10.1002/ijc.32663. Epub 2019 Oct 12.
36	Blood monocyte profiles in COPD patients with PiMM and PiZZ 1-antitrypsin.Respir Med. 2019 Mar;148:60-62. doi: 10.1016/j.rmed.2019.02.001. Epub 2019 Feb 6.
37	High-affinity CD16-polymorphism and Fc-engineered antibodies enable activity of CD16-chimeric antigen receptor-modified T cells for cancer therapy.Br J Cancer. 2019 Jan;120(1):79-87. doi: 10.1038/s41416-018-0341-1. Epub 2018 Nov 15.
38	Value of CD16/CD66b/CD45 in comparison to CD55/CD59/CD45 in diagnosis of paroxysmal nocturnal haemoglobinuria: An Indian experience.Indian J Med Res. 2017 Sep;146(3):362-368. doi: 10.4103/ijmr.IJMR_195_14.
39	Myelopoiesis dysregulation associated to sustained APRIL production in multiple myeloma-infiltrated bone marrow.Leukemia. 2015 Sep;29(9):1901-8. doi: 10.1038/leu.2015.68. Epub 2015 Mar 10.
40	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
41	The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
42	Copper deprivation enhances the chemosensitivity of pancreatic cancer to rapamycin by mTORC1/2 inhibition. Chem Biol Interact. 2023 Sep 1;382:110546. doi: 10.1016/j.cbi.2023.110546. Epub 2023 Jun 7.
43	Effect of aflatoxin B(1), benzo[a]pyrene, and methapyrilene on transcriptomic and epigenetic alterations in human liver HepaRG cells. Food Chem Toxicol. 2018 Nov;121:214-223. doi: 10.1016/j.fct.2018.08.034. Epub 2018 Aug 26.
44	The CD16(+) (FcgammaRIII(+)) subset of human monocytes preferentially becomes migratory dendritic cells in a model tissue setting. J Exp Med. 2002 Aug 19;196(4):517-27. doi: 10.1084/jem.20011608.