Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSSCTB5)

• DOT Name: TBC1 domain family member 9 (TBC1D9)
• Synonyms: TBC1 domain family member 9A
• Gene Name: TBC1D9
• Related Disease:
  Bladder cancer
  Childhood kidney Wilms tumor
  Colon adenocarcinoma
  Wilms tumor
  Autoimmune disease
  B-cell lymphoma
  Benign prostatic hyperplasia
  Blast phase chronic myelogenous leukemia, BCR-ABL1 positive
  Breast neoplasm
  Classic Hodgkin lymphoma
  Clear cell renal carcinoma
  Colitis
  Gallbladder carcinoma
  Glioma
  Lymphoid leukemia
  Metastatic malignant neoplasm
  Myelodysplastic syndrome
  Myeloid leukaemia
  Nephrotic syndrome
  Non-hodgkin lymphoma
  Ovarian neoplasm
  Pancreatic cancer
  Prostate carcinoma
  Renal cell carcinoma
  Rhabdomyosarcoma
  Rheumatoid arthritis
  Soft tissue sarcoma
  Squamous cell carcinoma
  Urinary bladder cancer
  Urinary bladder neoplasm
  Chromosomal disorder
  Cystic fibrosis
  Acute monocytic leukemia
  B-cell neoplasm
  Bone osteosarcoma
  Brain neoplasm
  Endometrial carcinoma
  Epithelial ovarian cancer
  Esophageal squamous cell carcinoma
  Familial adenomatous polyposis
  Liver cancer
  Lung carcinoma
  Melanoma
  Ovarian cancer
  Prostate cancer
• UniProt ID: TBCD9_HUMAN
• Pfam ID: PF02893 ; PF00566
• Sequence:
  MWVNPEEVLLANALWITERANPYFILQRRKGHAGDGGGGGGLAGLLVGTLDVVLDSSARV
  APYRILYQTPDSLVYWTIACGGSRKEITEHWEWLEQNLLQTLSIFENENDITTFVRGKIQ
  GIIAEYNKINDVKEDDDTEKFKEAIVKFHRLFGMPEEEKLVNYYSCSYWKGKVPRQGWMY
  LSINHLCFYSFLMGREAKLVIRWVDITQLEKNATLLLPDVIKVSTRSSEHFFSVFLNINE
  TFKLMEQLANIAMRQLLDNEGFEQDRSLPKLKRKSPKKVSALKRDLDARAKSERYRALFR
  LPKDEKLDGHTDCTLWTPFNKMHILGQMFVSTNYICFTSKEENLCSLIIPLREVTIVEKA
  DSSSVLPSPLSISTRNRMTFLFANLKDRDFLVQRISDFLQQTTSKIYSDKEFAGSYNSSD
  DEVYSRPSSLVSSSPQRSTSSDADGERQFNLNGNSVPTATQTLMTMYRRRSPEEFNPKLA
  KEFLKEQAWKIHFAEYGQGICMYRTEKTRELVLKGIPESMRGELWLLLSGAINEKATHPG
  YYEDLVEKSMGKYNLATEEIERDLHRSLPEHPAFQNEMGIAALRRVLTAYAFRNPNIGYC
  QAMNIVTSVLLLYAKEEEAFWLLVALCERMLPDYYNTRVVGALVDQGVFEELARDYVPQL
  YDCMQDLGVISTISLSWFLTLFLSVMPFESAVVVVDCFFYEGIKVIFQLALAVLDANVDK
  LLNCKDDGEAMTVLGRYLDSVTNKDSTLPPIPHLHSLLSDDVEPYPEVDIFRLIRTSYEK
  FGTIRADLIEQMRFKQRLKVIQTLEDTTKRNVVRTIVTETSFTIDELEELYALFKAEHLT
  SCYWGGSSNALDRHDPSLPYLEQYRIDFEQFKGMFALLFPWACGTHSDVLASRLFQLLDE
  NGDSLINFREFVSGLSAACHGDLTEKLKLLYKMHVLPEPSSDQDEPDSAFEATQYFFEDI
  TPECTHVVGLDSRSKQGADDGFVTVSLKPDKGKRANSQENRNYLRLWTPENKSKSKNAKD
  LPKLNQGQFIELCKTMYNMFSEDPNEQELYHATAAVTSLLLEIGEVGKLFVAQPAKEGGS
  GGSGPSCHQGIPGVLFPKKGPGQPYVVESVEPLPASLAPDSEEHSLGGQMEDIKLEDSSP
  RDNGACSSMLISDDDTKDDSSMSSYSVLSAGSHEEDKLHCEDIGEDTVLVRSGQGTAALP
  RSTSLDRDWAITFEQFLASLLTEPALVKYFDKPVCMMARITSAKNIRMMGKPLTSASDYE
  ISAMSG
• Function: May act as a GTPase-activating protein for Rab family protein(s).

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Bladder cancer	DISUHNM0	Definitive	Altered Expression	[1]
Childhood kidney Wilms tumor	DIS0NMK3	Definitive	Biomarker	[2]
Colon adenocarcinoma	DISDRE0J	Definitive	Altered Expression	[3]
Wilms tumor	DISB6T16	Definitive	Biomarker	[2]
Autoimmune disease	DISORMTM	Strong	Biomarker	[4]
B-cell lymphoma	DISIH1YQ	Strong	Biomarker	[5]
Benign prostatic hyperplasia	DISI3CW2	Strong	Posttranslational Modification	[6]
Blast phase chronic myelogenous leukemia, BCR-ABL1 positive	DIS3KLUX	Strong	Altered Expression	[7]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[8]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Biomarker	[9]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[10]
Colitis	DISAF7DD	Strong	Biomarker	[11]
Gallbladder carcinoma	DISD6ACL	Strong	Biomarker	[12]
Glioma	DIS5RPEH	Strong	Altered Expression	[13]
Lymphoid leukemia	DIS65TYQ	Strong	Genetic Variation	[14]
Metastatic malignant neoplasm	DIS86UK6	Strong	Genetic Variation	[15]
Myelodysplastic syndrome	DISYHNUI	Strong	Genetic Variation	[16]
Myeloid leukaemia	DISMN944	Strong	Genetic Variation	[14]
Nephrotic syndrome	DISSPSC2	Strong	Genetic Variation	[17]
Non-hodgkin lymphoma	DISS2Y8A	Strong	Genetic Variation	[18]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[19]
Pancreatic cancer	DISJC981	Strong	Biomarker	[20]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[21]
Renal cell carcinoma	DISQZ2X8	Strong	Altered Expression	[22]
Rhabdomyosarcoma	DISNR7MS	Strong	Biomarker	[23]
Rheumatoid arthritis	DISTSB4J	Strong	Genetic Variation	[24]
Soft tissue sarcoma	DISSN8XB	Strong	Altered Expression	[25]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[26]
Urinary bladder cancer	DISDV4T7	Strong	Altered Expression	[1]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[1]
Chromosomal disorder	DISM5BB5	moderate	Altered Expression	[27]
Cystic fibrosis	DIS2OK1Q	moderate	Altered Expression	[28]
Acute monocytic leukemia	DIS28NEL	Limited	Altered Expression	[29]
B-cell neoplasm	DISVY326	Limited	Altered Expression	[30]
Bone osteosarcoma	DIST1004	Limited	Altered Expression	[31]
Brain neoplasm	DISY3EKS	Limited	Altered Expression	[32]
Endometrial carcinoma	DISXR5CY	Limited	Altered Expression	[33]
Epithelial ovarian cancer	DIS56MH2	Limited	Genetic Variation	[34]
Esophageal squamous cell carcinoma	DIS5N2GV	Limited	Altered Expression	[35]
Familial adenomatous polyposis	DISW53RE	Limited	Biomarker	[36]
Liver cancer	DISDE4BI	Limited	Altered Expression	[37]
Lung carcinoma	DISTR26C	Limited	Genetic Variation	[38]
Melanoma	DIS1RRCY	Limited	Altered Expression	[39]
Ovarian cancer	DISZJHAP	Limited	Genetic Variation	[34]
Prostate cancer	DISF190Y	Limited	Biomarker	[21]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of TBC1 domain family member 9 (TBC1D9).	[40]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of TBC1 domain family member 9 (TBC1D9).	[41]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of TBC1 domain family member 9 (TBC1D9).	[42]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of TBC1 domain family member 9 (TBC1D9).	[43]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of TBC1 domain family member 9 (TBC1D9).	[44]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of TBC1 domain family member 9 (TBC1D9).	[45]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of TBC1 domain family member 9 (TBC1D9).	[46]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of TBC1 domain family member 9 (TBC1D9).	[47]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of TBC1 domain family member 9 (TBC1D9).	[48]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of TBC1 domain family member 9 (TBC1D9).	[49]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of TBC1 domain family member 9 (TBC1D9).	[50]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of TBC1 domain family member 9 (TBC1D9).	[51]

References

• [1] HIF-1/MDR1 pathway confers chemoresistance to cisplatin in bladder cancer.Oncol Rep. 2016 Mar;35(3):1549-56. doi: 10.3892/or.2015.4536. Epub 2015 Dec 29.
• [2] Simultaneous detection of MDR1 and WT1 gene expression to predict the prognosis of adult acute lymphoblastic leukemia.Hematology. 2010 Apr;15(2):74-80. doi: 10.1179/102453310X12583347009937.
• [3] Fucoxanthin attenuates rifampin-induced cytochrome P450 3A4 (CYP3A4) and multiple drug resistance 1 (MDR1) gene expression through pregnane X receptor (PXR)-mediated pathways in human hepatoma HepG2 and colon adenocarcinoma LS174T cells.Mar Drugs. 2012 Jan;10(1):242-257. doi: 10.3390/md10010242. Epub 2012 Jan 23.
• [4] P-glycoprotein gene MDR1 polymorphisms and susceptibility to systemic lupus erythematosus in Guangxi population: a case-control study.Rheumatol Int. 2017 Apr;37(4):537-545. doi: 10.1007/s00296-017-3652-2. Epub 2017 Feb 2.
• [5] A p110-specific inhibitor combined with bortezomib blocks drug resistance properties of EBV-related B cell origin cancer cells via regulation of NF-B.Int J Oncol. 2017 May;50(5):1711-1720. doi: 10.3892/ijo.2017.3923. Epub 2017 Mar 21.
• [6] Epigenetic regulation of MDR1 gene through post-translational histone modifications in prostate cancer.BMC Genomics. 2013 Dec 17;14:898. doi: 10.1186/1471-2164-14-898.
• [7] Multidrug resistance in leukemias and its reversal.Leuk Lymphoma. 1996 Nov;23(5-6):451-8. doi: 10.3109/10428199609054853.
• [8] Galectin-1 knockdown improves drug sensitivity of breast cancer by reducing P-glycoprotein expression through inhibiting the Raf-1/AP-1 signaling pathway.Oncotarget. 2017 Apr 11;8(15):25097-25106. doi: 10.18632/oncotarget.15341.
• [9] Inhibition of MDR1 Overcomes Resistance to Brentuximab Vedotin in Hodgkin Lymphoma.Clin Cancer Res. 2020 Mar 1;26(5):1034-1044. doi: 10.1158/1078-0432.CCR-19-1768. Epub 2019 Dec 6.
• [10] Correlation of (99m)Tc-sestamibi uptake in renal masses with mitochondrial content and multi-drug resistance pump expression.EJNMMI Res. 2017 Oct 2;7(1):80. doi: 10.1186/s13550-017-0329-5.
• [11] MDR1 deficiency impairs mitochondrial homeostasis and promotes intestinal inflammation.Mucosal Immunol. 2018 Jan;11(1):120-130. doi: 10.1038/mi.2017.31. Epub 2017 Apr 12.
• [12] PLAC8 overexpression correlates with PD-L1 upregulation and acquired resistance to chemotherapies in gallbladder carcinoma.Biochem Biophys Res Commun. 2019 Aug 27;516(3):983-990. doi: 10.1016/j.bbrc.2019.06.121. Epub 2019 Jul 2.
• [13] -Asarone promotes Temozolomide's entry into glioma cells and decreases the expression of P-glycoprotein and MDR1.Biomed Pharmacother. 2017 Jun;90:368-374. doi: 10.1016/j.biopha.2017.03.083. Epub 2017 Apr 2.
• [14] Association of MDR1 G2677T polymorphism and leukemia risk: evidence from a meta-analysis.Tumour Biol. 2014 Mar;35(3):2191-7. doi: 10.1007/s13277-013-1291-0. Epub 2013 Oct 20.
• [15] Microbiomic subprofiles and MDR1 promoter methylation in head and neck squamous cell carcinoma.Hum Mol Genet. 2012 Apr 1;21(7):1557-65. doi: 10.1093/hmg/ddr593. Epub 2011 Dec 15.
• [16] MDR-1 and GST polymorphisms are involved in myelodysplasia progression.Leuk Res. 2013 Aug;37(8):970-3. doi: 10.1016/j.leukres.2013.04.024. Epub 2013 May 17.
• [17] Multi-drug resistance-1 gene polymorphisms in nephrotic syndrome: impact on susceptibility and response to steroids.Gene. 2013 Nov 10;530(2):201-7. doi: 10.1016/j.gene.2013.08.045. Epub 2013 Aug 27.
• [18] Polymorphisms in DNA repair genes and MDR1 and the risk for non-Hodgkin lymphoma.Int J Mol Sci. 2014 Apr 21;15(4):6703-16. doi: 10.3390/ijms15046703.
• [19] Role of APC-mediated MDR-1/CLCX-1 signaling pathway in ovarian tumors.J Biol Regul Homeost Agents. 2018 May-Jun;32(3):529-536.
• [20] Commonality and differences of methylation signatures in the plasma of patients with pancreatic cancer and colorectal cancer.Int J Cancer. 2014 Jun 1;134(11):2656-62. doi: 10.1002/ijc.28593. Epub 2013 Nov 29.
• [21] Differential expression of the multidrug resistance 1 (MDR1) protein in prostate cancer cells is independent from anticancer drug treatment and Y box binding protein 1 (YB-1) activity.World J Urol. 2015 Oct;33(10):1481-6. doi: 10.1007/s00345-014-1469-0. Epub 2014 Dec 28.
• [22] Induction of the connexin 32 gene by epigallocatechin-3-gallate potentiates vinblastine-induced cytotoxicity in human renal carcinoma cells.Chemotherapy. 2013;59(3):192-9. doi: 10.1159/000354715. Epub 2013 Dec 3.
• [23] Induction of drug resistance in embryonal rhabdomyosarcoma treated with conventional chemotherapy is associated with HLA class I increase.Neoplasma. 2006;53(3):226-31.
• [24] Multidrug resistance 1 (MDR1) 3435C>T gene polymorphism influences the clinical phenotype and methotrexate-induced adverse events in South Indian Tamil rheumatoid arthritis. Eur J Clin Pharmacol. 2015 Aug;71(8):959-65.
• [25] MDR1 gene expression: evaluation of its use as a molecular marker for prognosis and chemotherapy of bone and soft tissue sarcomas.Eur J Cancer. 1996 Jan;32A(1):86-92. doi: 10.1016/0959-8049(95)00478-5.
• [26] Delivery of MTH1 inhibitor (TH287) and MDR1 siRNA via hyaluronic acid-based mesoporous silica nanoparticles for oral cancers treatment.Colloids Surf B Biointerfaces. 2019 Jan 1;173:599-606. doi: 10.1016/j.colsurfb.2018.09.076. Epub 2018 Sep 29.
• [27] MDR-1, but not MDR-3 gene expression, is associated with unmutated IgVH genes and poor prognosis chromosomal aberrations in chronic lymphocytic leukemia.Leuk Lymphoma. 2006 Nov;47(11):2308-13. doi: 10.1080/10428190600881421.
• [28] Sites of mRNA expression of the cystic fibrosis (CF) and multidrug resistance (MDR1) genes in the human placenta of early pregnancy: No evidence for complementary expression.Placenta. 1999 Jul-Aug;20(5-6):493-6. doi: 10.1053/plac.1999.0400.
• [29] Lung resistance-related protein (LRP) predicts favorable therapeutic outcome in Acute Myeloid Leukemia.Sci Rep. 2019 Jan 23;9(1):378. doi: 10.1038/s41598-018-36780-8.
• [30] Effectiveness of imatinib mesylate over etoposide in the treatment of sensitive and resistant chronic myeloid leukaemia cells in vitro.Exp Ther Med. 2017 Jun;13(6):3209-3216. doi: 10.3892/etm.2017.4443. Epub 2017 May 8.
• [31] TIPE2 sensitizes osteosarcoma cells to cis-platin by down-regulating MDR1 via the TAK1- NF-B and - AP-1 pathways.Mol Immunol. 2018 Sep;101:471-478. doi: 10.1016/j.molimm.2018.08.010. Epub 2018 Aug 14.
• [32] Targeting CD133 improves chemotherapeutic efficacy of recurrent pediatric pilocytic astrocytoma following prolonged chemotherapy.Mol Cancer. 2017 Jan 31;16(1):21. doi: 10.1186/s12943-017-0593-z.
• [33] Overcoming paclitaxel resistance in uterine endometrial cancer using a COX-2 inhibitor.Oncol Rep. 2013 Dec;30(6):2937-44. doi: 10.3892/or.2013.2790. Epub 2013 Oct 8.
• [34] TP53 mutation-mediated genomic instability induces the evolution of chemoresistance and recurrence in epithelial ovarian cancer.Diagn Pathol. 2017 Feb 2;12(1):16. doi: 10.1186/s13000-017-0605-8.
• [35] Entinostat reverses cisplatin resistance in esophageal squamous cell carcinoma via down-regulation of multidrug resistance gene 1.Cancer Lett. 2018 Feb 1;414:294-300. doi: 10.1016/j.canlet.2017.10.023. Epub 2017 Dec 5.
• [36] The action mechanism of lncRNA-HOTAIR on the drug resistance of non-small cell lung cancer by regulating Wnt signaling pathway.Exp Ther Med. 2018 Jun;15(6):4885-4889. doi: 10.3892/etm.2018.6052. Epub 2018 Apr 11.
• [37] Knockdown of TWIST enhances the cytotoxicity of chemotherapeutic drugs in doxorubicin-resistant HepG2 cells by suppressing MDR1 and EMT.Int J Oncol. 2018 Oct;53(4):1763-1773. doi: 10.3892/ijo.2018.4495. Epub 2018 Jul 20.
• [38] XRCC1 genetic polymorphism acts a potential biomarker for lung cancer.Tumour Biol. 2015 May;36(5):3745-50. doi: 10.1007/s13277-014-3014-6. Epub 2015 Jan 8.
• [39] Characterization of the typical multidrug resistance profile in human uveal melanoma cell lines and in mouse liver metastasis derivatives.Melanoma Res. 2005 Aug;15(4):257-66. doi: 10.1097/00008390-200508000-00005.
• [40] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [41] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [42] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [43] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [44] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [45] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [46] Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
• [47] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [48] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [49] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [50] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [51] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.