Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVSFHTL)

• DOT Name: Cysteine-rich secretory protein LCCL domain-containing 2 (CRISPLD2)
• Synonyms: Cysteine-rich secretory protein 11; CRISP-11; LCCL domain-containing cysteine-rich secretory protein 2
• Gene Name: CRISPLD2
• Related Disease:
  Acute myelogenous leukaemia
  Adult glioblastoma
  Alzheimer disease
  Atopic dermatitis
  Autosomal dominant epilepsy with auditory features
  Bronchopulmonary dysplasia
  Carcinoma of esophagus
  Cleft lip
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Congenital diaphragmatic hernia
  Cystic fibrosis
  Endometriosis
  Epilepsy, familial temporal lobe, 1
  Esophageal cancer
  Esophageal squamous cell carcinoma
  Glioblastoma multiforme
  Hepatocellular carcinoma
  Hereditary chronic pancreatitis
  Isolated cleft lip
  Liposarcoma
  Neoplasm
  Neoplasm of esophagus
  Non-insulin dependent diabetes
  Non-small-cell lung cancer
  Pancreatitis
  Plasma cell myeloma
  Primary hyperparathyroidism
  Pulmonary fibrosis
  Von willebrand disease
  Cleft palate
  Isolated cleft palate
  leukaemia
  Leukemia
  Subcortical band heterotopia
  Tropical pancreatitis
  Asthma
  Breast cancer
  Breast carcinoma
  Chronic urticaria
  Lung cancer
  Lung carcinoma
  Pulmonary disease
  Type-1/2 diabetes
• UniProt ID: CRLD2_HUMAN
• Pfam ID: PF00188 ; PF03815
• Sequence:
  MSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRAIPREDKEEIL
  MLHNKLRGQVQPQASNMEYMTWDDELEKSAAAWASQCIWEHGPTSLLVSIGQNLGAHWGR
  YRSPGFHVQSWYDEVKDYTYPYPSECNPWCPERCSGPMCTHYTQIVWATTNKIGCAVNTC
  RKMTVWGEVWENAVYFVCNYSPKGNWIGEAPYKNGRPCSECPPSYGGSCRNNLCYREETY
  TPKPETDEMNEVETAPIPEENHVWLQPRVMRPTKPKKTSAVNYMTQVVRCDTKMKDRCKG
  STCNRYQCPAGCLNHKAKIFGTLFYESSSSICRAAIHYGILDDKGGLVDITRNGKVPFFV
  KSERHGVQSLSKYKPSSSFMVSKVKVQDLDCYTTVAQLCPFEKPATHCPRIHCPAHCKDE
  PSYWAPVFGTNIYADTSSICKTAVHAGVISNESGGDVDVMPVDKKKTYVGSLRNGVQSES
  LGTPRDGKAFRIFAVRQ
• Function: Promotes matrix assembly.
• Reactome Pathway: Neutrophil degranulation (R-HSA-6798695)

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute myelogenous leukaemia	DISCSPTN	Strong	Altered Expression	[1]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[2]
Alzheimer disease	DISF8S70	Strong	Biomarker	[3]
Atopic dermatitis	DISTCP41	Strong	Biomarker	[4]
Autosomal dominant epilepsy with auditory features	DISFZN2O	Strong	Genetic Variation	[5]
Bronchopulmonary dysplasia	DISO0BY5	Strong	Biomarker	[6]
Carcinoma of esophagus	DISS6G4D	Strong	Biomarker	[7]
Cleft lip	DISV3XW6	Strong	Genetic Variation	[8]
Colon cancer	DISVC52G	Strong	Biomarker	[9]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[9]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[10]
Congenital diaphragmatic hernia	DIS0IPVU	Strong	Altered Expression	[11]
Cystic fibrosis	DIS2OK1Q	Strong	Altered Expression	[12]
Endometriosis	DISX1AG8	Strong	Altered Expression	[13]
Epilepsy, familial temporal lobe, 1	DISTRYUX	Strong	Genetic Variation	[5]
Esophageal cancer	DISGB2VN	Strong	Biomarker	[7]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Posttranslational Modification	[14]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[2]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[15]
Hereditary chronic pancreatitis	DISF0J1Q	Strong	Genetic Variation	[16]
Isolated cleft lip	DIS2O2JV	Strong	Genetic Variation	[8]
Liposarcoma	DIS8IZVM	Strong	Altered Expression	[17]
Neoplasm	DISZKGEW	Strong	Biomarker	[18]
Neoplasm of esophagus	DISOLKAQ	Strong	Biomarker	[7]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[19]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[20]
Pancreatitis	DIS0IJEF	Strong	Biomarker	[21]
Plasma cell myeloma	DIS0DFZ0	Strong	Altered Expression	[22]
Primary hyperparathyroidism	DISB4U1Q	Strong	Genetic Variation	[23]
Pulmonary fibrosis	DISQKVLA	Strong	Biomarker	[24]
Von willebrand disease	DIS3TZCH	Strong	Biomarker	[25]
Cleft palate	DIS6G5TF	moderate	Genetic Variation	[8]
Isolated cleft palate	DISV80CD	moderate	Genetic Variation	[8]
leukaemia	DISS7D1V	moderate	Biomarker	[26]
Leukemia	DISNAKFL	moderate	Biomarker	[26]
Subcortical band heterotopia	DISHN7JS	moderate	Biomarker	[27]
Tropical pancreatitis	DIS3OT4T	moderate	Genetic Variation	[28]
Asthma	DISW9QNS	Limited	Biomarker	[29]
Breast cancer	DIS7DPX1	Limited	Biomarker	[30]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[30]
Chronic urticaria	DISMBYB0	Limited	Biomarker	[31]
Lung cancer	DISCM4YA	Limited	Biomarker	[32]
Lung carcinoma	DISTR26C	Limited	Biomarker	[32]
Pulmonary disease	DIS6060I	Limited	Biomarker	[33]
Type-1/2 diabetes	DISIUHAP	Limited	Biomarker	[34]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Cysteine-rich secretory protein LCCL domain-containing 2 (CRISPLD2).	[35]

22 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Cysteine-rich secretory protein LCCL domain-containing 2 (CRISPLD2).	[36]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Cysteine-rich secretory protein LCCL domain-containing 2 (CRISPLD2).	[37]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Cysteine-rich secretory protein LCCL domain-containing 2 (CRISPLD2).	[38]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Cysteine-rich secretory protein LCCL domain-containing 2 (CRISPLD2).	[39]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Cysteine-rich secretory protein LCCL domain-containing 2 (CRISPLD2).	[40]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Cysteine-rich secretory protein LCCL domain-containing 2 (CRISPLD2).	[41]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Cysteine-rich secretory protein LCCL domain-containing 2 (CRISPLD2).	[42]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Cysteine-rich secretory protein LCCL domain-containing 2 (CRISPLD2).	[43]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Cysteine-rich secretory protein LCCL domain-containing 2 (CRISPLD2).	[44]
Dasatinib	DMJV2EK	Approved	Dasatinib increases the expression of Cysteine-rich secretory protein LCCL domain-containing 2 (CRISPLD2).	[45]
Amphotericin B	DMTAJQE	Approved	Amphotericin B increases the expression of Cysteine-rich secretory protein LCCL domain-containing 2 (CRISPLD2).	[46]
Mifepristone	DMGZQEF	Approved	Mifepristone decreases the expression of Cysteine-rich secretory protein LCCL domain-containing 2 (CRISPLD2).	[47]
Clodronate	DM9Y6X7	Approved	Clodronate increases the expression of Cysteine-rich secretory protein LCCL domain-containing 2 (CRISPLD2).	[48]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Cysteine-rich secretory protein LCCL domain-containing 2 (CRISPLD2).	[49]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Cysteine-rich secretory protein LCCL domain-containing 2 (CRISPLD2).	[50]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Cysteine-rich secretory protein LCCL domain-containing 2 (CRISPLD2).	[51]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Cysteine-rich secretory protein LCCL domain-containing 2 (CRISPLD2).	[52]
Mivebresib	DMCPF90	Phase 1	Mivebresib increases the expression of Cysteine-rich secretory protein LCCL domain-containing 2 (CRISPLD2).	[53]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Cysteine-rich secretory protein LCCL domain-containing 2 (CRISPLD2).	[54]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Cysteine-rich secretory protein LCCL domain-containing 2 (CRISPLD2).	[55]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Cysteine-rich secretory protein LCCL domain-containing 2 (CRISPLD2).	[56]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Cysteine-rich secretory protein LCCL domain-containing 2 (CRISPLD2).	[57]

References

• [1] Serum proteomic spectral characteristics of acute myeloid leukemia and their clinical significance.Genet Mol Res. 2017 Apr 13;16(2). doi: 10.4238/gmr16029172.
• [2] cDNA cloning of a novel trypsin inhibitor with similarity to pathogenesis-related proteins, and its frequent expression in human brain cancer cells.Biochim Biophys Acta. 1998 Jan 21;1395(2):202-8. doi: 10.1016/s0167-4781(97)00149-8.
• [3] Evolutionary origin of a Kunitz-type trypsin inhibitor domain inserted in the amyloid beta precursor protein of Alzheimer's disease.J Mol Evol. 1992 Jun;34(6):536-43. doi: 10.1007/BF00160466.
• [4] Mechanisms of abnormal lamellar body secretion and the dysfunctional skin barrier in patients with atopic dermatitis.J Allergy Clin Immunol. 2014 Oct;134(4):781-791.e1. doi: 10.1016/j.jaci.2014.05.048. Epub 2014 Aug 15.
• [5] Molecular basis of Mendelian idiopathic epilepsies.Ann Med. 2004;36(2):89-97. doi: 10.1080/07853890310019952.
• [6] LGL1 modulates proliferation, apoptosis, and migration of human fetal lung fibroblasts.Am J Physiol Lung Cell Mol Physiol. 2015 Feb 15;308(4):L391-402. doi: 10.1152/ajplung.00119.2014. Epub 2014 Dec 5.
• [7] Hugl-1 induces apoptosis in esophageal carcinoma cells both in vitro and in vivo.World J Gastroenterol. 2013 Jul 14;19(26):4127-36. doi: 10.3748/wjg.v19.i26.4127.
• [8] Association Between CRISPLD2 Polymorphisms and the Risk of Nonsyndromic Clefts of the Lip and/or Palate: A Meta-analysis.Cleft Palate Craniofac J. 2018 Mar;55(3):328-334. doi: 10.1177/1055665617738995. Epub 2017 Dec 14.
• [9] Trypsin is produced by and activates protease-activated receptor-2 in human cancer colon cells: evidence for new autocrine loop.Life Sci. 2002 Feb 8;70(12):1359-67. doi: 10.1016/s0024-3205(01)01519-3.
• [10] Reconstructed mung bean trypsin inhibitor targeting cell surface GRP78 induces apoptosis and inhibits tumor growth in colorectal cancer.Int J Biochem Cell Biol. 2014 Feb;47:68-75. doi: 10.1016/j.biocel.2013.11.022. Epub 2013 Dec 11.
• [11] The effects of tracheal occlusion on Wnt signaling in a rabbit model of congenital diaphragmatic hernia.J Pediatr Surg. 2019 May;54(5):937-944. doi: 10.1016/j.jpedsurg.2019.01.024. Epub 2019 Jan 31.
• [12] Deficiency of kallikrein activity in plasma of patients with cystic fibrosis.Science. 1972 Aug 18;177(4049):610-1. doi: 10.1126/science.177.4049.610.
• [13] CRISPLD2 is a target of progesterone receptor and its expression is decreased in women with endometriosis.PLoS One. 2014 Jun 23;9(6):e100481. doi: 10.1371/journal.pone.0100481. eCollection 2014.
• [14] Sporamin suppresses growth of human esophageal squamous cell carcinoma cells by inhibition of NFB via an AKTindependent pathway.Mol Med Rep. 2017 Dec;16(6):9620-9626. doi: 10.3892/mmr.2017.7772. Epub 2017 Oct 12.
• [15] Clinical and prognostic significance of urinary trypsin inhibitor in patients with hepatocellular carcinoma after hepatectomy.Ann Surg Oncol. 2009 Oct;16(10):2805-17. doi: 10.1245/s10434-009-0622-2. Epub 2009 Jul 28.
• [16] Absence of PRSS1 mutations and association of SPINK1 trypsin inhibitor mutations in hereditary and non-hereditary chronic pancreatitis.Gut. 2004 May;53(5):723-8. doi: 10.1136/gut.2003.026526.
• [17] A study of inter-alpha-trypsin inhibitor chains expression in liposarcomas.Eur J Surg Oncol. 2003 Oct;29(8):665-9. doi: 10.1016/s0748-7983(03)00135-5.
• [18] Lgl1 controls NG2 endocytic pathway to regulate oligodendrocyte differentiation and asymmetric cell division and gliomagenesis.Nat Commun. 2018 Aug 21;9(1):2862. doi: 10.1038/s41467-018-05099-3.
• [19] LUTI: a double-function inhibitor isolated from naked flax seeds.Acta Biochim Biophys Sin (Shanghai). 2019 Sep 6;51(10):989-996. doi: 10.1093/abbs/gmz087.
• [20] MiR-652-3p is upregulated in non-small cell lung cancer and promotes proliferation and metastasis by directly targeting Lgl1.Oncotarget. 2016 Mar 29;7(13):16703-15. doi: 10.18632/oncotarget.7697.
• [21] Characterization of dsRNA-induced pancreatitis model reveals the regulatory role of IFN regulatory factor 2 (Irf2) in trypsinogen5 gene transcription.Proc Natl Acad Sci U S A. 2011 Nov 15;108(46):18766-71. doi: 10.1073/pnas.1116273108. Epub 2011 Oct 31.
• [22] Expression of a buckwheat trypsin inhibitor gene in Escherichia coli and its effect on multiple myeloma IM-9 cell proliferation.Acta Biochim Biophys Sin (Shanghai). 2007 Sep;39(9):701-7. doi: 10.1111/j.1745-7270.2007.00332.x.
• [23] Pancreatitis risk in primary hyperparathyroidism: relation to mutations in the SPINK1 trypsin inhibitor (N34S) and the cystic fibrosis gene.Am J Gastroenterol. 2008 Feb;103(2):368-74. doi: 10.1111/j.1572-0241.2007.01695.x. Epub 2007 Dec 12.
• [24] Therapeutic effect of ulinastatin on pulmonary fibrosis via downregulation of TGF?, TNF?and NFB.Mol Med Rep. 2018 Jan;17(1):1717-1723. doi: 10.3892/mmr.2017.8056. Epub 2017 Nov 14.
• [25] The von Willebrand factor D'D3 assembly and structural principles for factor VIII binding and concatemer biogenesis.Blood. 2019 Apr 4;133(14):1523-1533. doi: 10.1182/blood-2018-10-876300. Epub 2019 Jan 14.
• [26] Isolation and Characterization of a Phaseolus vulgaris Trypsin Inhibitor with Antiproliferative Activity on Leukemia and Lymphoma Cells.Molecules. 2017 Jan 23;22(1):187. doi: 10.3390/molecules22010187.
• [27] Loss of Lgl1 Disrupts the Radial Glial Fiber-guided Cortical Neuronal Migration and Causes Subcortical Band Heterotopia in Mice.Neuroscience. 2019 Feb 21;400:132-145. doi: 10.1016/j.neuroscience.2018.12.039. Epub 2018 Dec 28.
• [28] Divergent roles of SPINK1 and PRSS2 variants in tropical calcific pancreatitis.Pancreatology. 2009;9(1-2):145-9. doi: 10.1159/000178885. Epub 2008 Dec 13.
• [29] Whole Genome Sequencing Identifies CRISPLD2 as a Lung Function Gene in Children With Asthma.Chest. 2019 Dec;156(6):1068-1079. doi: 10.1016/j.chest.2019.08.2202. Epub 2019 Sep 23.
• [30] ITIH5 mediates epigenetic reprogramming of breast cancer cells.Mol Cancer. 2017 Feb 23;16(1):44. doi: 10.1186/s12943-017-0610-2.
• [31] Protease inhibitor profiles in urticaria and angio-oedema.Br J Dermatol. 1980 Jul;103(1):33-9. doi: 10.1111/j.1365-2133.1980.tb15835.x.
• [32] Immune complexome analysis reveals the specific and frequent presence of immune complex antigens in lung cancer patients: A pilot study.Int J Cancer. 2017 Jan 15;140(2):370-380. doi: 10.1002/ijc.30455. Epub 2016 Oct 17.
• [33] Prenatal retinoic acid treatment upregulates late gestation lung protein 1 in the nitrofen-induced hypoplastic lung in late gestation.Pediatr Surg Int. 2011 Feb;27(2):125-9. doi: 10.1007/s00383-010-2783-2.
• [34] Significance of urinary glycosaminoglycans/proteoglycans in the evaluation of type 1 and type 2 diabetes complications.J Diabetes Complications. 2017 Jan;31(1):149-155. doi: 10.1016/j.jdiacomp.2016.10.013. Epub 2016 Oct 17.
• [35] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [36] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [37] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [38] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [39] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [40] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [41] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [42] Progesterone regulation of implantation-related genes: new insights into the role of oestrogen. Cell Mol Life Sci. 2007 Apr;64(7-8):1009-32.
• [43] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [44] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [45] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [46] Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
• [47] Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
• [48] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [49] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [50] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [51] Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
• [52] Synergistic effect of JQ1 and rapamycin for treatment of human osteosarcoma. Int J Cancer. 2015 May 1;136(9):2055-64.
• [53] Comprehensive transcriptome profiling of BET inhibitor-treated HepG2 cells. PLoS One. 2022 Apr 29;17(4):e0266966. doi: 10.1371/journal.pone.0266966. eCollection 2022.
• [54] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [55] Cystathionine metabolic enzymes play a role in the inflammation resolution of human keratinocytes in response to sub-cytotoxic formaldehyde exposure. Toxicol Appl Pharmacol. 2016 Nov 1;310:185-194.
• [56] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [57] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.