Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXHT3QO)

• DOT Name: Copper chaperone for superoxide dismutase (CCS)
• Synonyms: Superoxide dismutase copper chaperone
• Gene Name: CCS
• Related Disease:
  Coronary heart disease
  MEDNIK syndrome
  Prostate cancer
  Prostate carcinoma
  Acute myelogenous leukaemia
  Advanced cancer
  Alzheimer disease
  Amyotrophic lateral sclerosis
  Anxiety disorder
  Cardiac failure
  Colorectal carcinoma
  Congestive heart failure
  Dementia
  Depression
  Esophageal squamous cell carcinoma
  Major depressive disorder
  Malignant neoplasm
  Malignant soft tissue neoplasm
  Mood disorder
  Mucinous adenocarcinoma
  Narcolepsy
  Sarcoma
  Signet ring cell carcinoma
  Stroke
  Triple negative breast cancer
  Wilson disease
  Breast cancer
  Breast carcinoma
  Clear cell sarcoma
  Cutaneous mastocytosis
  Cytochrome-c oxidase deficiency disease
  Neoplasm
  Type-1/2 diabetes
• UniProt ID: CCS_HUMAN
• PDB ID: 1DO5; 2CRL; 2RSQ; 6FN8; 6FOL; 6FON; 6FP6
• Pfam ID: PF00403 ; PF00080
• Sequence:
  MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQ
  EVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTID
  GLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAI
  FRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNP
  KQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL
• Function: Delivers copper to copper zinc superoxide dismutase (SOD1).
• Tissue Specificity: Ubiquitous.
• KEGG Pathway:
  Amyotrophic lateral sclerosis (hsa05014)
  Pathways of neurodegeneration - multiple diseases (hsa05022)
• Reactome Pathway: Detoxification of Reactive Oxygen Species (R-HSA-3299685)

Molecular Interaction Atlas (MIA) of This DOT

33 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Coronary heart disease	DIS5OIP1	Definitive	Biomarker	[1]
MEDNIK syndrome	DISRF06E	Definitive	Genetic Variation	[2]
Prostate cancer	DISF190Y	Definitive	Altered Expression	[3]
Prostate carcinoma	DISMJPLE	Definitive	Altered Expression	[3]
Acute myelogenous leukaemia	DISCSPTN	Strong	Genetic Variation	[4]
Advanced cancer	DISAT1Z9	Strong	Genetic Variation	[5]
Alzheimer disease	DISF8S70	Strong	Biomarker	[6]
Amyotrophic lateral sclerosis	DISF7HVM	Strong	Biomarker	[7]
Anxiety disorder	DISBI2BT	Strong	Genetic Variation	[8]
Cardiac failure	DISDC067	Strong	Genetic Variation	[9]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[10]
Congestive heart failure	DIS32MEA	Strong	Genetic Variation	[9]
Dementia	DISXL1WY	Strong	Biomarker	[11]
Depression	DIS3XJ69	Strong	Genetic Variation	[8]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[12]
Major depressive disorder	DIS4CL3X	Strong	Genetic Variation	[13]
Malignant neoplasm	DISS6SNG	Strong	Biomarker	[9]
Malignant soft tissue neoplasm	DISTC6NO	Strong	Biomarker	[14]
Mood disorder	DISLVMWO	Strong	Genetic Variation	[8]
Mucinous adenocarcinoma	DISKNFE8	Strong	Genetic Variation	[15]
Narcolepsy	DISLCNLI	Strong	Genetic Variation	[8]
Sarcoma	DISZDG3U	Strong	Biomarker	[14]
Signet ring cell carcinoma	DISVCUCR	Strong	Genetic Variation	[15]
Stroke	DISX6UHX	Strong	Biomarker	[16]
Triple negative breast cancer	DISAMG6N	Strong	Biomarker	[17]
Wilson disease	DISVS9H7	Strong	Altered Expression	[18]
Breast cancer	DIS7DPX1	Limited	Altered Expression	[19]
Breast carcinoma	DIS2UE88	Limited	Altered Expression	[19]
Clear cell sarcoma	DIS1MTE6	Limited	Biomarker	[20]
Cutaneous mastocytosis	DISLBZEF	Limited	Biomarker	[21]
Cytochrome-c oxidase deficiency disease	DISK7N3G	Limited	Genetic Variation	[22]
Neoplasm	DISZKGEW	Limited	Biomarker	[19]
Type-1/2 diabetes	DISIUHAP	Limited	Genetic Variation	[23]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Copper chaperone for superoxide dismutase (CCS).	[24]

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Copper chaperone for superoxide dismutase (CCS).	[25]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Copper chaperone for superoxide dismutase (CCS).	[26]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Copper chaperone for superoxide dismutase (CCS).	[27]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Copper chaperone for superoxide dismutase (CCS).	[28]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Copper chaperone for superoxide dismutase (CCS).	[29]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of Copper chaperone for superoxide dismutase (CCS).	[30]
Etoposide	DMNH3PG	Approved	Etoposide increases the expression of Copper chaperone for superoxide dismutase (CCS).	[31]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Copper chaperone for superoxide dismutase (CCS).	[32]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of Copper chaperone for superoxide dismutase (CCS).	[33]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid decreases the expression of Copper chaperone for superoxide dismutase (CCS).	[34]
Coprexa	DMA0WEK	Phase 3	Coprexa decreases the expression of Copper chaperone for superoxide dismutase (CCS).	[36]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Copper chaperone for superoxide dismutase (CCS).	[37]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Copper chaperone for superoxide dismutase (CCS).	[38]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Copper chaperone for superoxide dismutase (CCS).	[39]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Copper chaperone for superoxide dismutase (CCS).	[40]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Hesperetin	DMKER83	Approved	Hesperetin affects the binding of Copper chaperone for superoxide dismutase (CCS).	[35]

References

• [1] The Athena trials: Autologous adipose-derived regenerative cells for refractory chronic myocardial ischemia with left ventricular dysfunction.Catheter Cardiovasc Interv. 2017 Feb 1;89(2):169-177. doi: 10.1002/ccd.26601. Epub 2016 Sep 23.
• [2] Inborn errors of copper metabolism.Handb Clin Neurol. 2013;113:1745-54. doi: 10.1016/B978-0-444-59565-2.00045-9.
• [3] Copper chaperone ATOX1 is required for MAPK signaling and growth in BRAF mutation-positive melanoma.Metallomics. 2019 Aug 1;11(8):1430-1440. doi: 10.1039/c9mt00042a. Epub 2019 Jul 18.
• [4] Genetic heterogeneity of cytogenetically normal AML with mutations of CEBPA.Blood Adv. 2018 Oct 23;2(20):2724-2731. doi: 10.1182/bloodadvances.2018016840.
• [5] Intra-abdominal recurrence from colorectal carcinoma: Differences and similarities between local and peritoneal recurrence.Surg Oncol. 2020 Mar;32:23-29. doi: 10.1016/j.suronc.2019.10.018. Epub 2019 Nov 4.
• [6] Role of Resveratrol and Selenium on Oxidative Stress and Expression of Antioxidant and Anti-Aging Genes in Immortalized Lymphocytes from Alzheimer's Disease Patients.Nutrients. 2019 Jul 31;11(8):1764. doi: 10.3390/nu11081764.
• [7] Monozygotic twins and triplets discordant for amyotrophic lateral sclerosis display differential methylation and gene expression.Sci Rep. 2019 Jun 4;9(1):8254. doi: 10.1038/s41598-019-44765-4.
• [8] High Rates of Psychiatric Comorbidity in Narcolepsy: Findings From the Burden of Narcolepsy Disease (BOND) Study of 9,312 Patients in the United States.J Clin Psychiatry. 2017 Feb;78(2):171-176. doi: 10.4088/JCP.15m10262.
• [9] Risk and Temporal Changes of Heart Failure Among 5-Year Childhood Cancer Survivors: a DCOG-LATER Study.J Am Heart Assoc. 2019 Jan 8;8(1):e009122. doi: 10.1161/JAHA.118.009122.
• [10] Functioning of people with colorectal cancer during chemotherapy. Demographic and clinical determinants of quality of life of patients with colorectal cancer receiving chemotherapy. Pilot study.Eur J Cancer Care (Engl). 2017 May;26(3). doi: 10.1111/ecc.12616. Epub 2016 Dec 27.
• [11] DEDICATE: proposal for a conceptual framework to develop dementia-friendly integrated eCare support.Biomed Eng Online. 2018 Sep 12;17(1):121. doi: 10.1186/s12938-018-0552-y.
• [12] Combination of c-reactive protein and squamous cell carcinoma antigen in predicting postoperative prognosis for patients with squamous cell carcinoma of the esophagus.Oncotarget. 2017 Jun 27;8(38):63132-63139. doi: 10.18632/oncotarget.18667. eCollection 2017 Sep 8.
• [13] Genome-wide association study of depression phenotypes in UK Biobank identifies variants in excitatory synaptic pathways.Nat Commun. 2018 Apr 16;9(1):1470. doi: 10.1038/s41467-018-03819-3.
• [14] Clear cell sarcoma of the gastrointestinal tract and malignant gastrointestinal neuroectodermal tumour: distinct or related entities? A review.Pathology. 2018 Aug;50(5):490-498. doi: 10.1016/j.pathol.2018.05.001. Epub 2018 Jun 30.
• [15] Prognoses of different pathological subtypes of colorectal cancer at different stages: A population-based retrospective cohort study.BMC Gastroenterol. 2019 Oct 10;19(1):164. doi: 10.1186/s12876-019-1083-0.
• [16] Etiological classification of ischemic stroke in young patients: a comparative study of TOAST, CCS, and ASCO.Acta Neurol Belg. 2017 Sep;117(3):643-648. doi: 10.1007/s13760-017-0813-8. Epub 2017 Jul 8.
• [17] Inhibition of Copper Transport Induces Apoptosis in Triple-Negative Breast Cancer Cells and Suppresses Tumor Angiogenesis. Mol Cancer Ther. 2019 May;18(5):873-885.
• [18] Mutation analysis of copper transporter genes in patients with ethylmalonic encephalopathy, mitochondriopathies and copper deficiency phenotypes.J Inherit Metab Dis. 2003;26(1):55-66. doi: 10.1023/a:1024027630589.
• [19] Copper Chaperone for Superoxide Dismutase Promotes Breast Cancer Cell Proliferation and Migration via ROS-Mediated MAPK/ERK Signaling.Front Pharmacol. 2019 Apr 5;10:356. doi: 10.3389/fphar.2019.00356. eCollection 2019.
• [20] Significance of MRI in the diagnosis and differentiation of clear cell sarcoma of tendon and aponeurosis (CCSTA): A case report.Medicine (Baltimore). 2018 Aug;97(31):e11012. doi: 10.1097/MD.0000000000011012.
• [21] Wnt1a maintains characteristics of dermal papilla cells that induce mouse hair regeneration in a 3D preculture system.J Tissue Eng Regen Med. 2017 May;11(5):1479-1489. doi: 10.1002/term.2046. Epub 2015 Jun 29.
• [22] Isolated cytochrome c oxidase deficiency in G93A SOD1 mice overexpressing CCS protein.J Biol Chem. 2008 May 2;283(18):12267-75. doi: 10.1074/jbc.M708523200. Epub 2008 Mar 11.
• [23] Assessment of Subclinical Atherosclerosis Using Computed Tomography Calcium Scores in Patients with Familial and Nonfamilial Hypercholesterolemia.J Atheroscler Thromb. 2016 May 2;23(5):588-95. doi: 10.5551/jat.31161. Epub 2015 Dec 14.
• [24] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [25] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [26] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [27] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [28] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [29] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [30] Chronic ethanol exposure increases goosecoid (GSC) expression in human embryonic carcinoma cell differentiation. J Appl Toxicol. 2014 Jan;34(1):66-75.
• [31] Genomic profiling uncovers a molecular pattern for toxicological characterization of mutagens and promutagens in vitro. Toxicol Sci. 2011 Jul;122(1):185-97.
• [32] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [33] Nicotine attenuates beta-amyloid-induced neurotoxicity by regulating metal homeostasis. FASEB J. 2006 Jun;20(8):1212-4.
• [34] Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
• [35] Various concentrations of hesperetin induce different types of programmed cell death in human breast cancerous and normal cell lines in a ROS-dependent manner. Chem Biol Interact. 2023 Sep 1;382:110642. doi: 10.1016/j.cbi.2023.110642. Epub 2023 Jul 23.
• [36] Copper deprivation enhances the chemosensitivity of pancreatic cancer to rapamycin by mTORC1/2 inhibition. Chem Biol Interact. 2023 Sep 1;382:110546. doi: 10.1016/j.cbi.2023.110546. Epub 2023 Jun 7.
• [37] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [38] Targeting MYCN in neuroblastoma by BET bromodomain inhibition. Cancer Discov. 2013 Mar;3(3):308-23.
• [39] Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.
• [40] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.