Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXOQDSG)

• DOT Name: Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1)
• Synonyms: IFIT-1; Interferon-induced 56 kDa protein; IFI-56K; P56
• Gene Name: IFIT1
• Related Disease:
  Rheumatoid arthritis
  Adult respiratory distress syndrome
  Angiomyolipoma
  Astrocytoma
  Cognitive impairment
  Cytomegalovirus infection
  Hepatitis B virus infection
  Hepatitis C virus infection
  Influenza
  Myelodysplastic syndrome
  Myopia
  Neoplasm
  Osteoporosis
  Squamous cell carcinoma
  Status epilepticus seizure
  Systemic lupus erythematosus
  Systemic sclerosis
  Zika virus infection
  Cervical carcinoma
  Chronic graft versus host disease
  Chronic obstructive pulmonary disease
  Endometriosis
  Hepatitis E virus infection
  Advanced cancer
  Bronchiolitis
• UniProt ID: IFIT1_HUMAN
• PDB ID: 4HOU; 5UDI; 5UDJ; 5UDK; 5UDL; 5W5H; 5W5I; 6C6K
• Pfam ID: PF13424 ; PF14559 ; PF07719 ; PF13181
• Sequence:
  MSTNGDDHQVKDSLEQLRCHFTWELSIDDDEMPDLENRVLDQIEFLDTKYSVGIHNLLAY
  VKHLKGQNEEALKSLKEAENLMQEEHDNQANVRSLVTWGNFAWMYYHMGRLAEAQTYLDK
  VENICKKLSNPFRYRMECPEIDCEEGWALLKCGGKNYERAKACFEKVLEVDPENPESSAG
  YAISAYRLDGFKLATKNHKPFSLLPLRQAVRLNPDNGYIKVLLALKLQDEGQEAEGEKYI
  EEALANMSSQTYVFRYAAKFYRRKGSVDKALELLKKALQETPTSVLLHHQIGLCYKAQMI
  QIKEATKGQPRGQNREKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNHRKAE
  ENFQKLLCMKPVVEETMQDIHFHYGRFQEFQKKSDVNAIIHYLKAIKIEQASLTRDKSIN
  SLKKLVLRKLRRKALDLESLSLLGFVYKLEGNMNEALEYYERALRLAADFENSVRQGP
• Function: Interferon-induced antiviral RNA-binding protein that specifically binds single-stranded RNA bearing a 5'-triphosphate group (PPP-RNA), thereby acting as a sensor of viral single-stranded RNAs and inhibiting expression of viral messenger RNAs. Single-stranded PPP-RNAs, which lack 2'-O-methylation of the 5' cap and bear a 5'-triphosphate group instead, are specific from viruses, providing a molecular signature to distinguish between self and non-self mRNAs by the host during viral infection. Directly binds PPP-RNA in a non-sequence-specific manner. Viruses evolved several ways to evade this restriction system such as encoding their own 2'-O-methylase for their mRNAs or by stealing host cap containing the 2'-O-methylation (cap snatching mechanism). Exhibits antiviral activity against several viruses including human papilloma and hepatitis C viruses.
• KEGG Pathway: Hepatitis C (hsa05160)
• Reactome Pathway:
  Interferon alpha/beta signaling (R-HSA-909733)
  ISG15 antiviral mechanism (R-HSA-1169408)

Molecular Interaction Atlas (MIA) of This DOT

25 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Rheumatoid arthritis	DISTSB4J	Definitive	Biomarker	[1]
Adult respiratory distress syndrome	DISIJV47	Strong	Biomarker	[2]
Angiomyolipoma	DIS2L71N	Strong	Biomarker	[3]
Astrocytoma	DISL3V18	Strong	Altered Expression	[4]
Cognitive impairment	DISH2ERD	Strong	Biomarker	[5]
Cytomegalovirus infection	DISCEMGC	Strong	Biomarker	[6]
Hepatitis B virus infection	DISLQ2XY	Strong	Genetic Variation	[7]
Hepatitis C virus infection	DISQ0M8R	Strong	Biomarker	[8]
Influenza	DIS3PNU3	Strong	Biomarker	[9]
Myelodysplastic syndrome	DISYHNUI	Strong	Altered Expression	[10]
Myopia	DISK5S60	Strong	Biomarker	[11]
Neoplasm	DISZKGEW	Strong	Altered Expression	[12]
Osteoporosis	DISF2JE0	Strong	Biomarker	[13]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[12]
Status epilepticus seizure	DISY3BIC	Strong	Genetic Variation	[14]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[15]
Systemic sclerosis	DISF44L6	Strong	Altered Expression	[16]
Zika virus infection	DISQUCTY	Strong	Altered Expression	[17]
Cervical carcinoma	DIST4S00	moderate	Biomarker	[18]
Chronic graft versus host disease	DIS1MM9J	moderate	Biomarker	[19]
Chronic obstructive pulmonary disease	DISQCIRF	moderate	Altered Expression	[20]
Endometriosis	DISX1AG8	Disputed	Biomarker	[21]
Hepatitis E virus infection	DIS0TXIR	Disputed	Biomarker	[22]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[12]
Bronchiolitis	DISEE9BG	Limited	Altered Expression	[23]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
DTI-015	DMXZRW0	Approved	Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1) affects the response to substance of DTI-015.	[55]

40 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[24]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[25]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[26]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[27]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[28]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[29]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[30]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[25]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[31]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[32]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[33]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[34]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[35]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[21]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[37]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[38]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[39]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[40]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[41]
Diclofenac	DMPIHLS	Approved	Diclofenac decreases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[40]
Permethrin	DMZ0Q1G	Approved	Permethrin increases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[42]
Gemcitabine	DMSE3I7	Approved	Gemcitabine increases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[37]
Liothyronine	DM6IR3P	Approved	Liothyronine decreases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[43]
Bicalutamide	DMZMSPF	Approved	Bicalutamide decreases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[44]
Prednisolone	DMQ8FR2	Approved	Prednisolone decreases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[40]
Methylprednisolone	DM4BDON	Approved	Methylprednisolone decreases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[40]
Tofacitinib	DMBS370	Approved	Tofacitinib decreases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[45]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[46]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[47]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol decreases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[34]
Jakafi	DMNORK8	Phase 3	Jakafi decreases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[45]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[48]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[31]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[49]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[50]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[51]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[24]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[52]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[53]
Paraquat	DMR8O3X	Investigative	Paraquat affects the expression of Interferon-induced protein with tetratricopeptide repeats 1 (IFIT1).	[54]

References

• [1] Type I Interferon Gene Response Is Increased in Early and Established Rheumatoid Arthritis and Correlates with Autoantibody Production.Front Immunol. 2017 Mar 20;8:285. doi: 10.3389/fimmu.2017.00285. eCollection 2017.
• [2] Extremes of Interferon-Stimulated Gene Expression Associate with Worse Outcomes in the Acute Respiratory Distress Syndrome.PLoS One. 2016 Sep 8;11(9):e0162490. doi: 10.1371/journal.pone.0162490. eCollection 2016.
• [3] Mutation in TSC2 and activation of mammalian target of rapamycin signalling pathway in renal angiomyolipoma.Lancet. 2003 Apr 19;361(9366):1348-9. doi: 10.1016/S0140-6736(03)13044-9.
• [4] ISG54 and ISG56 are induced by TLR3 signaling in U373MG human astrocytoma cells: possible involvement in CXCL10 expression.Neurosci Res. 2014 Jul;84:34-42. doi: 10.1016/j.neures.2014.03.001. Epub 2014 Mar 11.
• [5] Key role of soluble epoxide hydrolase in the neurodevelopmental disorders of offspring after maternal immune activation.Proc Natl Acad Sci U S A. 2019 Apr 2;116(14):7083-7088. doi: 10.1073/pnas.1819234116. Epub 2019 Mar 19.
• [6] Antiviral effects of IFIT1 in human cytomegalovirus-infected fetal astrocytes.J Med Virol. 2017 Apr;89(4):672-684. doi: 10.1002/jmv.24674. Epub 2016 Sep 9.
• [7] IFIT1 polymorphisms predict interferon- treatment efficiency for hepatitis B virus infection.World J Gastroenterol. 2016 Nov 28;22(44):9813-9821. doi: 10.3748/wjg.v22.i44.9813.
• [8] Hepatic IFN-Induced Protein with Tetratricopeptide Repeats Regulation of HCV Infection.J Interferon Cytokine Res. 2019 Mar;39(3):133-146. doi: 10.1089/jir.2018.0103.
• [9] A host transcriptional signature for presymptomatic detection of infection in humans exposed to influenza H1N1 or H3N2.PLoS One. 2013;8(1):e52198. doi: 10.1371/journal.pone.0052198. Epub 2013 Jan 9.
• [10] Gene expression profiles of CD34+ cells in myelodysplastic syndromes: involvement of interferon-stimulated genes and correlation to FAB subtype and karyotype.Blood. 2006 Jul 1;108(1):337-45. doi: 10.1182/blood-2005-12-4769. Epub 2006 Mar 9.
• [11] Genetic deletion of the adenosine A2A receptor confers postnatal development of relative myopia in mice.Invest Ophthalmol Vis Sci. 2010 Sep;51(9):4362-70. doi: 10.1167/iovs.09-3998. Epub 2010 May 19.
• [12] IFIT1 and IFIT3 promote oral squamous cell carcinoma metastasis and contribute to the anti-tumor effect of gefitinib via enhancing p-EGFR recycling.Oncogene. 2019 Apr;38(17):3232-3247. doi: 10.1038/s41388-018-0662-9. Epub 2019 Jan 9.
• [13] Identification of novel genes associated with fracture healing in osteoporosis induced by Krm2 overexpression or Lrp5 deficiency.Mol Med Rep. 2017 Jun;15(6):3969-3976. doi: 10.3892/mmr.2017.6544. Epub 2017 May 3.
• [14] Altered Synaptic Drive onto Birthdated Dentate Granule Cells in Experimental Temporal Lobe Epilepsy.J Neurosci. 2019 Sep 18;39(38):7604-7614. doi: 10.1523/JNEUROSCI.0654-18.2019. Epub 2019 Jul 3.
• [15] Type I Interferon Signature in Primary Antiphospholipid Syndrome: Clinical and Laboratory Associations.Front Immunol. 2019 Mar 15;10:487. doi: 10.3389/fimmu.2019.00487. eCollection 2019.
• [16] Identification of NF-B and PLCL2 as new susceptibility genes and highlights on a potential role of IRF8 through interferon signature modulation in systemic sclerosis.Arthritis Res Ther. 2015 Mar 21;17(1):71. doi: 10.1186/s13075-015-0572-y.
• [17] IFIT3 and IFIT2/3 promote IFIT1-mediated translation inhibition by enhancing binding to non-self RNA.Nucleic Acids Res. 2018 Jun 1;46(10):5269-5285. doi: 10.1093/nar/gky191.
• [18] Identification of a promoter in position 56 within the long control region of human papillomavirus type 18.Arch Virol. 2001;146(11):2069-84. doi: 10.1007/s007050170021.
• [19] Biomarkers for acute and chronic graft-versus-host disease in regulatory T cells.Transpl Immunol. 2012 Dec;27(4):179-83. doi: 10.1016/j.trim.2012.07.003. Epub 2012 Aug 4.
• [20] Human Metapneumovirus Infection in Chronic Obstructive Pulmonary Disease: Impact of Glucocorticosteroids and Interferon.J Infect Dis. 2017 May 15;215(10):1536-1545. doi: 10.1093/infdis/jix167.
• [21] Unique transcriptome, pathways, and networks in the human endometrial fibroblast response to progesterone in endometriosis. Biol Reprod. 2011 Apr;84(4):801-15.
• [22] Hepatitis E virus polymerase binds to IFIT1 to protect the viral RNA from IFIT1-mediated translation inhibition.J Gen Virol. 2019 Mar;100(3):471-483. doi: 10.1099/jgv.0.001229. Epub 2019 Jan 31.
• [23] Evaluation of viral load in infants hospitalized with bronchiolitis caused by respiratory syncytial virus.Med Microbiol Immunol. 2012 Aug;201(3):311-7. doi: 10.1007/s00430-012-0233-6. Epub 2012 Mar 10.
• [24] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [25] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [26] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [27] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [28] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [29] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [30] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [31] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [32] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [33] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [34] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [35] Evaluation of early biomarkers of muscle anabolic response to testosterone. J Cachexia Sarcopenia Muscle. 2011 Mar;2(1):45-56. doi: 10.1007/s13539-011-0021-y. Epub 2011 Feb 26.
• [36] Unique transcriptome, pathways, and networks in the human endometrial fibroblast response to progesterone in endometriosis. Biol Reprod. 2011 Apr;84(4):801-15.
• [37] Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
• [38] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [39] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [40] Antirheumatic drug response signatures in human chondrocytes: potential molecular targets to stimulate cartilage regeneration. Arthritis Res Ther. 2009;11(1):R15.
• [41] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [42] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [43] Monitoring of deiodinase deficiency based on transcriptomic responses in SH-SY5Y cells. Arch Toxicol. 2013 Jun;87(6):1103-13. doi: 10.1007/s00204-013-1018-4. Epub 2013 Feb 10.
• [44] Microarray analysis of bicalutamide action on telomerase activity, p53 pathway and viability of prostate carcinoma cell lines. J Pharm Pharmacol. 2005 Jan;57(1):83-92.
• [45] Regulation of inflammatory responses in tumor necrosis factor-activated and rheumatoid arthritis synovial macrophages by JAK inhibitors. Arthritis Rheum. 2012 Dec;64(12):3856-66. doi: 10.1002/art.37691.
• [46] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [47] Integrated transcriptomic and metabolomic analyses to characterize the anti-cancer effects of (-)-epigallocatechin-3-gallate in human colon cancer cells. Toxicol Appl Pharmacol. 2020 Aug 15;401:115100. doi: 10.1016/j.taap.2020.115100. Epub 2020 Jun 6.
• [48] Dose- and time-dependent transcriptional response of Ishikawa cells exposed to genistein. Toxicol Sci. 2016 May;151(1):71-87.
• [49] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [50] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [51] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [52] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [53] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [54] CD34+ derived macrophage and dendritic cells display differential responses to paraquat. Toxicol In Vitro. 2021 Sep;75:105198. doi: 10.1016/j.tiv.2021.105198. Epub 2021 Jun 9.
• [55] Tumor necrosis factor-alpha-induced protein 3 as a putative regulator of nuclear factor-kappaB-mediated resistance to O6-alkylating agents in human glioblastomas. J Clin Oncol. 2006 Jan 10;24(2):274-87. doi: 10.1200/JCO.2005.02.9405. Epub 2005 Dec 19.