Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTY5HZN5)

• DOT Name: Leucine-rich repeats and immunoglobulin-like domains protein 1 (LRIG1)
• Synonyms: LIG-1
• Gene Name: LRIG1
• Related Disease:
  Chronic renal failure
  Malignant glioma
  Medullary thyroid gland carcinoma
  Thyroid cancer
  Thyroid gland carcinoma
  Thyroid gland papillary carcinoma
  Thyroid tumor
  Adenoma
  Adult glioblastoma
  Advanced cancer
  Atrial fibrillation
  B-cell neoplasm
  Breast neoplasm
  Cardiovascular disease
  Central nervous system neoplasm
  Clear cell renal carcinoma
  Colon cancer
  Colorectal adenocarcinoma
  Colorectal cancer
  Colorectal cancer, susceptibility to, 1
  Colorectal cancer, susceptibility to, 10
  Colorectal cancer, susceptibility to, 12
  Colorectal neoplasm
  Dermatitis
  Gastric cancer
  Glioblastoma multiforme
  Head and neck cancer
  Head and neck carcinoma
  Kidney neoplasm
  Neoplasm
  Prostate cancer
  Prostate carcinoma
  Renal cell carcinoma
  Rheumatoid arthritis
  Skin neoplasm
  Squamous cell carcinoma
  Stomach cancer
  Breast cancer
  Colon carcinoma
  Familial atrial fibrillation
  Nasopharyngeal carcinoma
  Non-small-cell lung cancer
  Small lymphocytic lymphoma
  Breast carcinoma
  Glioma
  Melanoma
  Metastatic malignant neoplasm
• UniProt ID: LRIG1_HUMAN
• PDB ID: 4U7L; 4U7M
• Pfam ID: PF07679 ; PF13927 ; PF12799 ; PF13855 ; PF01463
• Sequence:
  MARPVRGGLGAPRRSPCLLLLWLLLLRLEPVTAAAGPRAPCAAACTCAGDSLDCGGRGLA
  ALPGDLPSWTRSLNLSYNKLSEIDPAGFEDLPNLQEVYLNNNELTAVPSLGAASSHVVSL
  FLQHNKIRSVEGSQLKAYLSLEVLDLSLNNITEVRNTCFPHGPPIKELNLAGNRIGTLEL
  GAFDGLSRSLLTLRLSKNRITQLPVRAFKLPRLTQLDLNRNRIRLIEGLTFQGLNSLEVL
  KLQRNNISKLTDGAFWGLSKMHVLHLEYNSLVEVNSGSLYGLTALHQLHLSNNSIARIHR
  KGWSFCQKLHELVLSFNNLTRLDEESLAELSSLSVLRLSHNSISHIAEGAFKGLRSLRVL
  DLDHNEISGTIEDTSGAFSGLDSLSKLTLFGNKIKSVAKRAFSGLEGLEHLNLGGNAIRS
  VQFDAFVKMKNLKELHISSDSFLCDCQLKWLPPWLIGRMLQAFVTATCAHPESLKGQSIF
  SVPPESFVCDDFLKPQIITQPETTMAMVGKDIRFTCSAASSSSSPMTFAWKKDNEVLTNA
  DMENFVHVHAQDGEVMEYTTILHLRQVTFGHEGRYQCVITNHFGSTYSHKARLTVNVLPS
  FTKTPHDITIRTTTMARLECAATGHPNPQIAWQKDGGTDFPAARERRMHVMPDDDVFFIT
  DVKIDDAGVYSCTAQNSAGSISANATLTVLETPSLVVPLEDRVVSVGETVALQCKATGNP
  PPRITWFKGDRPLSLTERHHLTPDNQLLVVQNVVAEDAGRYTCEMSNTLGTERAHSQLSV
  LPAAGCRKDGTTVGIFTIAVVSSIVLTSLVWVCIIYQTRKKSEEYSVTNTDETVVPPDVP
  SYLSSQGTLSDRQETVVRTEGGPQANGHIESNGVCPRDASHFPEPDTHSVACRQPKLCAG
  SAYHKEPWKAMEKAEGTPGPHKMEHGGRVVCSDCNTEVDCYSRGQAFHPQPVSRDSAQPS
  APNGPEPGGSDQEHSPHHQCSRTAAGSCPECQGSLYPSNHDRMLTAVKKKPMASLDGKGD
  SSWTLARLYHPDSTELQPASSLTSGSPERAEAQYLLVSNGHLPKACDASPESTPLTGQLP
  GKQRVPLLLAPKS
• Function: Acts as a feedback negative regulator of signaling by receptor tyrosine kinases, through a mechanism that involves enhancement of receptor ubiquitination and accelerated intracellular degradation.
• Tissue Specificity: Widely expressed.
• Reactome Pathway:
  Negative regulation of MET activity (R-HSA-6807004)
  Signaling by EGFR (R-HSA-177929)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Chronic renal failure	DISGG7K6	Definitive	Genetic Variation	[1]
Malignant glioma	DISFXKOV	Definitive	Biomarker	[2]
Medullary thyroid gland carcinoma	DISHBL3K	Definitive	Altered Expression	[3]
Thyroid cancer	DIS3VLDH	Definitive	Genetic Variation	[3]
Thyroid gland carcinoma	DISMNGZ0	Definitive	Genetic Variation	[3]
Thyroid gland papillary carcinoma	DIS48YMM	Definitive	Altered Expression	[3]
Thyroid tumor	DISLVKMD	Definitive	Genetic Variation	[3]
Adenoma	DIS78ZEV	Strong	Biomarker	[4]
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[2]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[5]
Atrial fibrillation	DIS15W6U	Strong	Genetic Variation	[6]
B-cell neoplasm	DISVY326	Strong	Altered Expression	[7]
Breast neoplasm	DISNGJLM	Strong	Genetic Variation	[8]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[9]
Central nervous system neoplasm	DISFC18W	Strong	Genetic Variation	[10]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[11]
Colon cancer	DISVC52G	Strong	Biomarker	[12]
Colorectal adenocarcinoma	DISPQOUB	Strong	Genetic Variation	[13]
Colorectal cancer	DISNH7P9	Strong	Genetic Variation	[13]
Colorectal cancer, susceptibility to, 1	DISZ794C	Strong	Genetic Variation	[13]
Colorectal cancer, susceptibility to, 10	DISQXMYM	Strong	Genetic Variation	[13]
Colorectal cancer, susceptibility to, 12	DIS4FXJX	Strong	Genetic Variation	[13]
Colorectal neoplasm	DISR1UCN	Strong	Genetic Variation	[13]
Dermatitis	DISY5SZC	Strong	Biomarker	[14]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[15]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[2]
Head and neck cancer	DISBPSQZ	Strong	Altered Expression	[16]
Head and neck carcinoma	DISOU1DS	Strong	Altered Expression	[16]
Kidney neoplasm	DISBNZTN	Strong	Altered Expression	[17]
Neoplasm	DISZKGEW	Strong	Biomarker	[18]
Prostate cancer	DISF190Y	Strong	Biomarker	[19]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[19]
Renal cell carcinoma	DISQZ2X8	Strong	Altered Expression	[11]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[9]
Skin neoplasm	DIS16DDV	Strong	Altered Expression	[20]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[21]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[15]
Breast cancer	DIS7DPX1	moderate	Altered Expression	[22]
Colon carcinoma	DISJYKUO	moderate	Biomarker	[12]
Familial atrial fibrillation	DISL4AGF	moderate	Biomarker	[6]
Nasopharyngeal carcinoma	DISAOTQ0	moderate	Biomarker	[23]
Non-small-cell lung cancer	DIS5Y6R9	moderate	Biomarker	[24]
Small lymphocytic lymphoma	DIS30POX	moderate	Altered Expression	[25]
Breast carcinoma	DIS2UE88	Limited	Altered Expression	[22]
Glioma	DIS5RPEH	Limited	Altered Expression	[26]
Melanoma	DIS1RRCY	Limited	Biomarker	[27]
Metastatic malignant neoplasm	DIS86UK6	Limited	Biomarker	[8]

21 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Leucine-rich repeats and immunoglobulin-like domains protein 1 (LRIG1).	[28]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Leucine-rich repeats and immunoglobulin-like domains protein 1 (LRIG1).	[29]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Leucine-rich repeats and immunoglobulin-like domains protein 1 (LRIG1).	[30]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Leucine-rich repeats and immunoglobulin-like domains protein 1 (LRIG1).	[31]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Leucine-rich repeats and immunoglobulin-like domains protein 1 (LRIG1).	[32]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Leucine-rich repeats and immunoglobulin-like domains protein 1 (LRIG1).	[33]
Arsenic	DMTL2Y1	Approved	Arsenic affects the expression of Leucine-rich repeats and immunoglobulin-like domains protein 1 (LRIG1).	[34]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Leucine-rich repeats and immunoglobulin-like domains protein 1 (LRIG1).	[35]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Leucine-rich repeats and immunoglobulin-like domains protein 1 (LRIG1).	[36]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Leucine-rich repeats and immunoglobulin-like domains protein 1 (LRIG1).	[37]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Leucine-rich repeats and immunoglobulin-like domains protein 1 (LRIG1).	[36]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Leucine-rich repeats and immunoglobulin-like domains protein 1 (LRIG1).	[38]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Leucine-rich repeats and immunoglobulin-like domains protein 1 (LRIG1).	[39]
Panobinostat	DM58WKG	Approved	Panobinostat decreases the expression of Leucine-rich repeats and immunoglobulin-like domains protein 1 (LRIG1).	[37]
Cytarabine	DMZD5QR	Approved	Cytarabine increases the expression of Leucine-rich repeats and immunoglobulin-like domains protein 1 (LRIG1).	[40]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Leucine-rich repeats and immunoglobulin-like domains protein 1 (LRIG1).	[41]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Leucine-rich repeats and immunoglobulin-like domains protein 1 (LRIG1).	[42]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Leucine-rich repeats and immunoglobulin-like domains protein 1 (LRIG1).	[43]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Leucine-rich repeats and immunoglobulin-like domains protein 1 (LRIG1).	[44]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Leucine-rich repeats and immunoglobulin-like domains protein 1 (LRIG1).	[46]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Leucine-rich repeats and immunoglobulin-like domains protein 1 (LRIG1).	[47]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Leucine-rich repeats and immunoglobulin-like domains protein 1 (LRIG1).	[45]

References

• [1] Identification of CDC42BPG as a novel susceptibility locus for hyperuricemia in a Japanese population.Mol Genet Genomics. 2018 Apr;293(2):371-379. doi: 10.1007/s00438-017-1394-1. Epub 2017 Nov 9.
• [2] Lrig1 is a haploinsufficient tumor suppressor gene in malignant glioma.Oncogenesis. 2018 Feb 2;7(2):13. doi: 10.1038/s41389-017-0012-8.
• [3] LRIG1 negatively regulates RET mutants and is downregulated in thyroid cancer.Int J Oncol. 2018 Apr;52(4):1189-1197. doi: 10.3892/ijo.2018.4273. Epub 2018 Feb 9.
• [4] LRIG1 is a triple threat: ERBB negative regulator, intestinal stem cell marker and tumour suppressor.Br J Cancer. 2013 May 14;108(9):1765-70. doi: 10.1038/bjc.2013.138. Epub 2013 Apr 4.
• [5] A protein interaction network centered on leucine-rich repeats and immunoglobulin-like domains 1 (LRIG1) regulates growth factor receptors.J Biol Chem. 2018 Mar 2;293(9):3421-3435. doi: 10.1074/jbc.M117.807487. Epub 2018 Jan 9.
• [6] Multi-ethnic genome-wide association study for atrial fibrillation.Nat Genet. 2018 Jun 11;50(9):1225-1233. doi: 10.1038/s41588-018-0133-9.
• [7] Investigation of the association between miR?81b, Bcl? and LRIG1 in oral verrucous carcinoma.Mol Med Rep. 2016 Oct;14(4):2991-6. doi: 10.3892/mmr.2016.5608. Epub 2016 Aug 9.
• [8] Loss of LRIG1 locus increases risk of early and late relapse of stage I/II breast cancer.Cancer Res. 2014 Jun 1;74(11):2928-35. doi: 10.1158/0008-5472.CAN-13-2112.
• [9] Influence of coronary artery disease and subclinical atherosclerosis related polymorphisms on the risk of atherosclerosis in rheumatoid arthritis.Sci Rep. 2017 Jan 6;7:40303. doi: 10.1038/srep40303.
• [10] Genome-wide association study of glioma subtypes identifies specific differences in genetic susceptibility to glioblastoma and non-glioblastoma tumors.Nat Genet. 2017 May;49(5):789-794. doi: 10.1038/ng.3823. Epub 2017 Mar 27.
• [11] LRIG1 and epidermal growth factor receptor in renal cell carcinoma: a quantitative RT--PCR and immunohistochemical analysis.Br J Cancer. 2003 Oct 6;89(7):1285-9. doi: 10.1038/sj.bjc.6601208.
• [12] A Unique Nonsaccharide Mimetic of Heparin Hexasaccharide Inhibits Colon Cancer Stem Cells via p38 MAP Kinase Activation.Mol Cancer Ther. 2019 Jan;18(1):51-61. doi: 10.1158/1535-7163.MCT-18-0104. Epub 2018 Oct 18.
• [13] Novel Common Genetic Susceptibility Loci for Colorectal Cancer.J Natl Cancer Inst. 2019 Feb 1;111(2):146-157. doi: 10.1093/jnci/djy099.
• [14] Hair eruption initiates and commensal skin microbiota aggravate adverse events of anti-EGFR therapy.Sci Transl Med. 2019 Dec 11;11(522):eaax2693. doi: 10.1126/scitranslmed.aax2693.
• [15] Downregulation of leucine-rich repeats and immunoglobulin-like domains 1 by microRNA-20a modulates gastric cancer multidrug resistance.Cancer Sci. 2018 Apr;109(4):1044-1054. doi: 10.1111/cas.13538. Epub 2018 Mar 23.
• [16] LRIG1 modulates aggressiveness of head and neck cancers by regulating EGFR-MAPK-SPHK1 signaling and extracellular matrix remodeling.Oncogene. 2014 Mar 13;33(11):1375-84. doi: 10.1038/onc.2013.98. Epub 2013 Apr 29.
• [17] Cloning of a new familial t(3;8) translocation associated with conventional renal cell carcinoma reveals a 5 kb microdeletion and no gene involved in the rearrangement.Hum Mol Genet. 2004 May 1;13(9):983-90. doi: 10.1093/hmg/ddh111. Epub 2004 Mar 11.
• [18] IL-17R-EGFR axis links wound healing to tumorigenesis in Lrig1(+) stem cells.J Exp Med. 2019 Jan 7;216(1):195-214. doi: 10.1084/jem.20171849. Epub 2018 Dec 21.
• [19] LRIG1 is a pleiotropic androgen receptor-regulated feedback tumor suppressor in prostate cancer.Nat Commun. 2019 Dec 2;10(1):5494. doi: 10.1038/s41467-019-13532-4.
• [20] A role for Rac1 activity in malignant progression of sebaceous skin tumors.Oncogene. 2015 Oct;34(43):5505-12. doi: 10.1038/onc.2014.471. Epub 2015 Feb 9.
• [21] HPV-Induced Field Cancerisation: Transformation of Adult Tissue Stem Cell Into Cancer Stem Cell.Front Microbiol. 2018 Mar 26;9:546. doi: 10.3389/fmicb.2018.00546. eCollection 2018.
• [22] Decreased LRIG1 in fulvestrant-treated luminal breast cancer cells permits ErbB3 upregulation and increased growth.Oncogene. 2016 Mar 3;35(9):1143-52. doi: 10.1038/onc.2015.169. Epub 2015 Jul 6.
• [23] LRIG and cancer prognosis.Acta Oncol. 2014 Sep;53(9):1135-42. doi: 10.3109/0284186X.2014.953258. Epub 2014 Sep 2.
• [24] Tumor-suppressive effect of LRIG1, a negative regulator of ErbB, in non-small cell lung cancer harboring mutant EGFR.Carcinogenesis. 2018 May 3;39(5):719-727. doi: 10.1093/carcin/bgy044.
• [25] Investigating the targets of MIR-15a and MIR-16-1 in patients with chronic lymphocytic leukemia (CLL).PLoS One. 2009 Sep 25;4(9):e7169. doi: 10.1371/journal.pone.0007169.
• [26] Resveratrol inhibits glioma cell growth via targeting LRIG1.J BUON. 2018 Mar-Apr;23(2):403-409.
• [27] Isoliquiritigenin suppresses human melanoma growth by targeting miR-301b/LRIG1 signaling.J Exp Clin Cancer Res. 2018 Aug 6;37(1):184. doi: 10.1186/s13046-018-0844-x.
• [28] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [29] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [30] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [31] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [32] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [33] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [34] Drinking-water arsenic exposure modulates gene expression in human lymphocytes from a U.S. population. Environ Health Perspect. 2008 Apr;116(4):524-31. doi: 10.1289/ehp.10861.
• [35] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [36] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [37] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [38] Unique transcriptome, pathways, and networks in the human endometrial fibroblast response to progesterone in endometriosis. Biol Reprod. 2011 Apr;84(4):801-15.
• [39] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [40] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [41] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [42] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [43] Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
• [44] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [45] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [46] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [47] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.