Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTY917X0)

• DOT Name: Nuclear receptor corepressor 2 (NCOR2)
• Synonyms: N-CoR2; CTG repeat protein 26; SMAP270; Silencing mediator of retinoic acid and thyroid hormone receptor; SMRT; T3 receptor-associating factor; TRAC; Thyroid-, retinoic-acid-receptor-associated corepressor
• Gene Name: NCOR2
• Related Disease:
  Adult glioblastoma
  Ataxia-telangiectasia
  Autosomal dominant polycystic kidney disease
  B-cell lymphoma
  B-cell neoplasm
  Bartsocas-Papas syndrome 1
  Benign adult familial myoclonic epilepsy
  Breast cancer
  Breast carcinoma
  Classic Hodgkin lymphoma
  Clubfoot
  Estrogen-receptor positive breast cancer
  Glioblastoma multiforme
  Hepatocellular carcinoma
  HIV infectious disease
  Hypothyroidism
  Immunodeficiency
  Leiomyoma
  leukaemia
  Leukemia
  Lung adenocarcinoma
  Lymphoma, non-Hodgkin, familial
  Mental disorder
  Metabolic disorder
  Myocardial infarction
  Non-hodgkin lymphoma
  Non-insulin dependent diabetes
  Osteoarthritis
  Plasma cell myeloma
  Premature aging syndrome
  Prostate neoplasm
  Spinal muscular atrophy
  Uterine fibroids
  Advanced cancer
  Ductal breast carcinoma in situ
  Head-neck squamous cell carcinoma
  Neuroblastoma
  Promyelocytic leukaemia
  Generalized resistance to thyroid hormone
  Castration-resistant prostate carcinoma
  Cocaine addiction
  Myelofibrosis
  Primary myelofibrosis
  Prostate cancer
  Prostate carcinoma
  Rett syndrome
• UniProt ID: NCOR2_HUMAN
• PDB ID: 1KKQ; 1R2B; 1XC5; 2GPV; 2L5G; 2LTP; 2ODD; 2RT5; 3R29; 3R2A; 4A69; 4OAR; 5X8Q; 5X8X; 5ZOO; 5ZOP; 6A22; 6IVX; 6PDZ; 7SQA; 8AQM; 8AQN; 8B8W; 8B8X; 8B8Y; 8B8Z; 8B90; 8B91; 8B92; 8B93; 8B94; 8B95
• Pfam ID: PF15784 ; PF00249
• Sequence:
  MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHTDVGLLEYQHHSRDYASHLSPGSIIQ
  PQRRRPSLLSEFQPGNERSQELHLRPESHSYLPELGKSEMEFIESKRPRLELLPDPLLRP
  SPLLATGQPAGSEDLTKDRSLTGKLEPVSPPSPPHTDPELELVPPRLSKEELIQNMDRVD
  REITMVEQQISKLKKKQQQLEEEAAKPPEPEKPVSPPPIESKHRSLVQIIYDENRKKAEA
  AHRILEGLGPQVELPLYNQPSDTRQYHENIKINQAMRKKLILYFKRRNHARKQWEQKFCQ
  RYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQERMQSRVGQRGSG
  LSMSAARSEHEVSEIIDGLSEQENLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMADPM
  KVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTKKNENYK
  SLVRRSYRRRGKSQQQQQQQQQQQQQQQQQPMPRSSQEEKDEKEKEKEAEKEEEKPEVEN
  DKEDLLKEKTDDTSGEDNDEKEAVASKGRKTANSQGRRKGRITRSMANEANSEEAITPQQ
  SAELASMELNESSRWTEEEMETAKKGLLEHGRNWSAIARMVGSKTVSQCKNFYFNYKKRQ
  NLDEILQQHKLKMEKERNARRKKKKAPAAASEEAAFPPVVEDEEMEASGVSGNEEEMVEE
  AEALHASGNEVPRGECSGPATVNNSSDTESIPSPHTEAAKDTGQNGPKPPATLGADGPPP
  GPPTPPPEDIPAPTEPTPASEATGAPTPPPAPPSPSAPPPVVPKEEKEEETAAAPPVEEG
  EEQKPPAAEELAVDTGKAEEPVKSECTEEAEEGPAKGKDAEAAEATAEGALKAEKKEGGS
  GRATTAKSSGAPQDSDSSATCSADEVDEAEGGDKNRLLSPRPSLLTPTGDPRANASPQKP
  LDLKQLKQRAAAIPPIQVTKVHEPPREDAAPTKPAPPAPPPPQNLQPESDAPQQPGSSPR
  GKSRSPAPPADKEAFAAEAQKLPGDPPCWTSGLPFPVPPREVIKASPHAPDPSAFSYAPP
  GHPLPLGLHDTARPVLPRPPTISNPPPLISSAKHPSVLERQIGAISQGMSVQLHVPYSEH
  AKAPVGPVTMGLPLPMDPKKLAPFSGVKQEQLSPRGQAGPPESLGVPTAQEASVLRGTAL
  GSVPGGSITKGIPSTRVPSDSAITYRGSITHGTPADVLYKGTITRIIGEDSPSRLDRGRE
  DSLPKGHVIYEGKKGHVLSYEGGMSVTQCSKEDGRSSSGPPHETAAPKRTYDMMEGRVGR
  AISSASIEGLMGRAIPPERHSPHHLKEQHHIRGSITQGIPRSYVEAQEDYLRREAKLLKR
  EGTPPPPPPSRDLTEAYKTQALGPLKLKPAHEGLVATVKEAGRSIHEIPREELRHTPELP
  LAPRPLKEGSITQGTPLKYDTGASTTGSKKHDVRSLIGSPGRTFPPVHPLDVMADARALE
  RACYEESLKSRPGTASSSGGSIARGAPVIVPELGKPRQSPLTYEDHGAPFAGHLPRGSPV
  TTREPTPRLQEGSLSSSKASQDRKLTSTPREIAKSPHSTVPEHHPHPISPYEHLLRGVSG
  VDLYRSHIPLAFDPTSIPRGIPLDAAAAYYLPRHLAPNPTYPHLYPPYLIRGYPDTAALE
  NRQTIINDYITSQQMHHNAATAMAQRADMLRGLSPRESSLALNYAAGPRGIIDLSQVPHL
  PVLVPPTPGTPATAMDRLAYLPTAPQPFSSRHSSSPLSPGGPTHLTKPTTTSSSERERDR
  DRERDRDREREKSILTSTTTVEHAPIWRPGTEQSSGSSGGGGGSSSRPASHSHAHQHSPI
  SPRTQDALQQRPSVLHNTGMKGIITAVEPSTPTVLRSTSTSSPVRPAATFPPATHCPLGG
  TLDGVYPTLMEPVLLPKEAPRVARPERPRADTGHAFLAKPPARSGLEPASSPSKGSEPRP
  LVPPVSGHATIARTPAKNLAPHHASPDPPAPPASASDPHREKTQSKPFSIQELELRSLGY
  HGSSYSPEGVEPVSPVSSPSLTHDKGLPKHLEELDKSHLEGELRPKQPGPVKLGGEAAHL
  PHLRPLPESQPSSSPLLQTAPGVKGHQRVVTLAQHISEVITQDYTRHHPQQLSAPLPAPL
  YSFPGASCPVLDLRRPPSDLYLPPPDHGAPARGSPHSEGGKRSPEPNKTSVLGGGEDGIE
  PVSPPEGMTEPGHSRSAVYPLLYRDGEQTEPSRMGSKSPGNTSQPPAFFSKLTESNSAMV
  KSKKQEINKKLNTHNRNEPEYNISQPGTEIFNMPAITGTGLMTYRSQAVQEHASTNMGLE
  AIIRKALMGKYDQWEESPPLSANAFNPLNASASLPAAMPITAADGRSDHTLTSPGGGGKA
  KVSGRPSSRKAKSPAPGLASGDRPPSVSSVHSEGDCNRRTPLTNRVWEDRPSSAGSTPFP
  YNPLIMRLQAGVMASPPPPGLPAGSGPLAGPHHAWDEEPKPLLCSQYETLSDSE
• Function: Transcriptional corepressor. Mediates the transcriptional repression activity of some nuclear receptors by promoting chromatin condensation, thus preventing access of the basal transcription. Isoform 1 and isoform 4 have different affinities for different nuclear receptors. Involved in the regulation BCL6-dependent of the germinal center (GC) reactions, mainly through the control of the GC B-cells proliferation and survival. Recruited by ZBTB7A to the androgen response elements/ARE on target genes, negatively regulates androgen receptor signaling and androgen-induced cell proliferation.
• Tissue Specificity: Ubiquitous. High levels of expression are detected in lung, spleen and brain.
• KEGG Pathway:
  Notch sig.ling pathway (hsa04330)
  Epstein-Barr virus infection (hsa05169)
• Reactome Pathway:
  NOTCH1 Intracellular Domain Regulates Transcription (R-HSA-2122947)
  Downregulation of SMAD2/3 (R-HSA-2173795)
  Constitutive Signaling by NOTCH1 PEST Domain Mutants (R-HSA-2644606)
  Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants (R-HSA-2894862)
  HDACs deacetylate histones (R-HSA-3214815)
  Notch-HLH transcription pathway (R-HSA-350054)
  Transcriptional regulation of white adipocyte differentiation (R-HSA-381340)
  Nuclear Receptor transcription pathway (R-HSA-383280)
  SUMOylation of transcription cofactors (R-HSA-3899300)
  Regulation of lipid metabolism by PPARalpha (R-HSA-400206)
  Loss of MECP2 binding ability to the NCoR/SMRT complex (R-HSA-9022537)
  Regulation of MECP2 expression and activity (R-HSA-9022692)
  NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux (R-HSA-9029569)
  HCMV Early Events (R-HSA-9609690)
  NR1H2 & NR1H3 regulate gene expression to control bile acid homeostasis (R-HSA-9623433)
  Cytoprotection by HMOX1 (R-HSA-9707564)
  PPARA activates gene expression (R-HSA-1989781)

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[1]
Ataxia-telangiectasia	DISP3EVR	Strong	Biomarker	[2]
Autosomal dominant polycystic kidney disease	DISBHWUI	Strong	Genetic Variation	[3]
B-cell lymphoma	DISIH1YQ	Strong	Biomarker	[4]
B-cell neoplasm	DISVY326	Strong	Altered Expression	[5]
Bartsocas-Papas syndrome 1	DIS12QS5	Strong	Posttranslational Modification	[6]
Benign adult familial myoclonic epilepsy	DISIMWOV	Strong	Biomarker	[7]
Breast cancer	DIS7DPX1	Strong	Genetic Variation	[8]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[8]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Genetic Variation	[9]
Clubfoot	DISLXT4S	Strong	Genetic Variation	[10]
Estrogen-receptor positive breast cancer	DIS1H502	Strong	Biomarker	[11]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[1]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[12]
HIV infectious disease	DISO97HC	Strong	Genetic Variation	[13]
Hypothyroidism	DISR0H6D	Strong	Altered Expression	[14]
Immunodeficiency	DIS093I0	Strong	Biomarker	[13]
Leiomyoma	DISLDDFN	Strong	Altered Expression	[15]
leukaemia	DISS7D1V	Strong	Genetic Variation	[16]
Leukemia	DISNAKFL	Strong	Genetic Variation	[16]
Lung adenocarcinoma	DISD51WR	Strong	Altered Expression	[17]
Lymphoma, non-Hodgkin, familial	DISCXYIZ	Strong	Biomarker	[9]
Mental disorder	DIS3J5R8	Strong	Biomarker	[18]
Metabolic disorder	DIS71G5H	Strong	Biomarker	[19]
Myocardial infarction	DIS655KI	Strong	Genetic Variation	[20]
Non-hodgkin lymphoma	DISS2Y8A	Strong	Biomarker	[9]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Genetic Variation	[19]
Osteoarthritis	DIS05URM	Strong	Biomarker	[21]
Plasma cell myeloma	DIS0DFZ0	Strong	Altered Expression	[22]
Premature aging syndrome	DIS51AGT	Strong	Biomarker	[19]
Prostate neoplasm	DISHDKGQ	Strong	Altered Expression	[23]
Spinal muscular atrophy	DISTLKOB	Strong	Genetic Variation	[24]
Uterine fibroids	DISBZRMJ	Strong	Altered Expression	[15]
Advanced cancer	DISAT1Z9	moderate	Genetic Variation	[25]
Ductal breast carcinoma in situ	DISLCJY7	moderate	Biomarker	[26]
Head-neck squamous cell carcinoma	DISF7P24	moderate	Altered Expression	[27]
Neuroblastoma	DISVZBI4	moderate	Biomarker	[28]
Promyelocytic leukaemia	DISYGG13	moderate	Biomarker	[29]
Generalized resistance to thyroid hormone	DIS4TOK0	Disputed	Biomarker	[30]
Castration-resistant prostate carcinoma	DISVGAE6	Limited	Biomarker	[31]
Cocaine addiction	DISHTRXG	Limited	Genetic Variation	[32]
Myelofibrosis	DISIMP21	Limited	Biomarker	[33]
Primary myelofibrosis	DIS6L0CN	Limited	Biomarker	[33]
Prostate cancer	DISF190Y	Limited	Biomarker	[34]
Prostate carcinoma	DISMJPLE	Limited	Biomarker	[34]
Rett syndrome	DISGG5UV	Limited	Genetic Variation	[35]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Nuclear receptor corepressor 2 (NCOR2).	[36]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Nuclear receptor corepressor 2 (NCOR2).	[37]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Nuclear receptor corepressor 2 (NCOR2).	[38]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Nuclear receptor corepressor 2 (NCOR2).	[39]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Nuclear receptor corepressor 2 (NCOR2).	[41]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Nuclear receptor corepressor 2 (NCOR2).	[42]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene increases the expression of Nuclear receptor corepressor 2 (NCOR2).	[44]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Nuclear receptor corepressor 2 (NCOR2).	[46]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Nuclear receptor corepressor 2 (NCOR2).	[48]
Butanoic acid	DMTAJP7	Investigative	Butanoic acid increases the expression of Nuclear receptor corepressor 2 (NCOR2).	[50]
crotylaldehyde	DMTWRQI	Investigative	crotylaldehyde decreases the expression of Nuclear receptor corepressor 2 (NCOR2).	[51]
U0126	DM31OGF	Investigative	U0126 decreases the expression of Nuclear receptor corepressor 2 (NCOR2).	[52]

7 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Nuclear receptor corepressor 2 (NCOR2).	[40]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Nuclear receptor corepressor 2 (NCOR2).	[43]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Nuclear receptor corepressor 2 (NCOR2).	[45]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Nuclear receptor corepressor 2 (NCOR2).	[47]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Nuclear receptor corepressor 2 (NCOR2).	[49]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Nuclear receptor corepressor 2 (NCOR2).	[43]
Coumarin	DM0N8ZM	Investigative	Coumarin affects the phosphorylation of Nuclear receptor corepressor 2 (NCOR2).	[49]

References

• [1] microRNA-100 targets SMRT/NCOR2, reduces proliferation, and improves survival in glioblastoma animal models.PLoS One. 2013 Nov 14;8(11):e80865. doi: 10.1371/journal.pone.0080865. eCollection 2013.
• [2] SMRT compounds abrogate cellular phenotypes of ataxia telangiectasia in neural derivatives of patient-specific hiPSCs.Nat Commun. 2013;4:1824. doi: 10.1038/ncomms2824.
• [3] Pilot Study of the Occurrence of Somatic Mutations in Ciliary Signalling Pathways as a Contribution Factor to Autosomal Dominant Polycystic Kidney Development.Folia Biol (Praha). 2017;63(5-6):174-181.
• [4] BCL6 programs lymphoma cells for survival and differentiation through distinct biochemical mechanisms.Blood. 2007 Sep 15;110(6):2067-74. doi: 10.1182/blood-2007-01-069575. Epub 2007 Jun 1.
• [5] Discovery of high-affinity BCL6-binding peptide and its structure-activity relationship.Biochem Biophys Res Commun. 2017 Jan 8;482(2):310-316. doi: 10.1016/j.bbrc.2016.11.060. Epub 2016 Nov 14.
• [6] Biomarkers in the diagnosis and symptom assessment of patients with bladder pain syndrome: a systematic review.Int Urogynecol J. 2019 Nov;30(11):1785-1794. doi: 10.1007/s00192-019-04075-9. Epub 2019 Aug 13.
• [7] Detecting a long insertion variant in SAMD12 by SMRT sequencing: implications of long-read whole-genome sequencing for repeat expansion diseases.J Hum Genet. 2019 Mar;64(3):191-197. doi: 10.1038/s10038-018-0551-7. Epub 2018 Dec 17.
• [8] BQ323636.1, a Novel Splice Variant to NCOR2, as a Predictor for Tamoxifen-Resistant Breast Cancer.Clin Cancer Res. 2018 Aug 1;24(15):3681-3691. doi: 10.1158/1078-0432.CCR-17-2259. Epub 2018 Feb 2.
• [9] Alteration of SMRT tumor suppressor function in transformed non-Hodgkin lymphomas.Cancer Res. 2005 Jun 1;65(11):4554-61. doi: 10.1158/0008-5472.CAN-04-4108.
• [10] Genome-wide association study identifies new disease loci for isolated clubfoot.J Med Genet. 2014 May;51(5):334-9. doi: 10.1136/jmedgenet-2014-102303. Epub 2014 Mar 25.
• [11] CITED2 and NCOR2 in anti-oestrogen resistance and progression of breast cancer.Br J Cancer. 2009 Dec 1;101(11):1824-32. doi: 10.1038/sj.bjc.6605423. Epub 2009 Nov 10.
• [12] LncRNA MIR22HG inhibits growth, migration and invasion through regulating the miR-10a-5p/NCOR2 axis in hepatocellular carcinoma cells.Cancer Sci. 2019 Mar;110(3):973-984. doi: 10.1111/cas.13950. Epub 2019 Feb 23.
• [13] Genetic associations of variants in genes encoding HIV-dependency factors required for HIV-1 infection.J Infect Dis. 2010 Dec 15;202(12):1836-45. doi: 10.1086/657322.
• [14] Coactivator and corepressor gene expression in rat cerebellum during postnatal development and the effect of altered thyroid status.Endocrinology. 2000 May;141(5):1693-8. doi: 10.1210/endo.141.5.7467.
• [15] Relaxin signaling in uterine fibroids.Ann N Y Acad Sci. 2009 Apr;1160:374-8. doi: 10.1111/j.1749-6632.2008.03803.x.
• [16] The leukemia-associated gene TEL encodes a transcription repressor which associates with SMRT and mSin3A.Biochem Biophys Res Commun. 1999 Nov 2;264(3):871-7. doi: 10.1006/bbrc.1999.1605.
• [17] HP1 Promotes Lung Adenocarcinoma by Downregulating the Transcription-Repressive Regulators NCOR2 and ZBTB7A.Cancer Res. 2018 Jul 15;78(14):3834-3848. doi: 10.1158/0008-5472.CAN-17-3571. Epub 2018 May 15.
• [18] The microRNA network is altered in anterior cingulate cortex of patients with unipolar and bipolar depression.J Psychiatr Res. 2016 Nov;82:58-67. doi: 10.1016/j.jpsychires.2016.07.012. Epub 2016 Jul 18.
• [19] Nuclear receptor corepressor SMRT regulates mitochondrial oxidative metabolism and mediates aging-related metabolic deterioration.Cell Metab. 2010 Dec 1;12(6):643-53. doi: 10.1016/j.cmet.2010.11.007.
• [20] Association of a polymorphism of BTN2A1 with myocardial infarction in East Asian populations.Atherosclerosis. 2011 Mar;215(1):145-52. doi: 10.1016/j.atherosclerosis.2010.12.005. Epub 2010 Dec 15.
• [21] Association study of candidate genes for the prevalence and progression of knee osteoarthritis.Arthritis Rheum. 2004 Aug;50(8):2497-507. doi: 10.1002/art.20443.
• [22] Loss of the SMRT/NCoR2 corepressor correlates with JAG2 overexpression in multiple myeloma.Cancer Res. 2009 May 15;69(10):4380-7. doi: 10.1158/0008-5472.CAN-08-3467. Epub 2009 May 5.
• [23] Altered SMRT levels disrupt vitamin D3 receptor signalling in prostate cancer cells.Oncogene. 2004 Sep 2;23(40):6712-25. doi: 10.1038/sj.onc.1207772.
• [24] Methylation levels of SLC23A2 and NCOR2 genes correlate with spinal muscular atrophy severity. PLoS One. 2015 Mar 30;10(3):e0121964.
• [25] Tamoxifen Resistance Trumped and Oral Selective Estrogen Receptor Degraders Arrive.Clin Cancer Res. 2018 Aug 1;24(15):3480-3482. doi: 10.1158/1078-0432.CCR-18-0759. Epub 2018 Apr 19.
• [26] Expression levels of estrogen receptor-alpha, estrogen receptor-beta, coactivators, and corepressors in breast cancer.Clin Cancer Res. 2000 Feb;6(2):512-8.
• [27] The pregnane X receptor (PXR) and the nuclear receptor corepressor 2 (NCoR2) modulate cell growth in head and neck squamous cell carcinoma.PLoS One. 2018 Feb 22;13(2):e0193242. doi: 10.1371/journal.pone.0193242. eCollection 2018.
• [28] Differential effects of retinoic acid isomers on the expression of nuclear receptor co-regulators in neuroblastoma.FEBS Lett. 1999 Feb 26;445(2-3):415-9. doi: 10.1016/s0014-5793(99)00162-3.
• [29] Variant-type PML-RAR(alpha) fusion transcript in acute promyelocytic leukemia: use of a cryptic coding sequence from intron 2 of the RAR(alpha) gene and identification of a new clinical subtype resistant to retinoic acid therapy.Proc Natl Acad Sci U S A. 2002 May 28;99(11):7640-5. doi: 10.1073/pnas.112194799.
• [30] Search for abnormalities of nuclear corepressors, coactivators, and a coregulator in families with resistance to thyroid hormone without mutations in thyroid hormone receptor beta or alpha genes.J Clin Endocrinol Metab. 2000 Oct;85(10):3609-17. doi: 10.1210/jcem.85.10.6873.
• [31] DUB3 Promotes BET Inhibitor Resistance and Cancer Progression by Deubiquitinating BRD4.Mol Cell. 2018 Aug 16;71(4):592-605.e4. doi: 10.1016/j.molcel.2018.06.036. Epub 2018 Jul 26.
• [32] Genome-wide association study of cocaine dependence and related traits: FAM53B identified as a risk gene.Mol Psychiatry. 2014 Jun;19(6):717-23. doi: 10.1038/mp.2013.99. Epub 2013 Aug 20.
• [33] Rescue of a primary myelofibrosis model by retinoid-antagonist therapy.Proc Natl Acad Sci U S A. 2013 Nov 19;110(47):18820-5. doi: 10.1073/pnas.1318974110. Epub 2013 Nov 4.
• [34] Altered corepressor SMRT expression and recruitment to target genes as a mechanism that change the response to androgens in prostate cancer progression.Biochem Biophys Res Commun. 2012 Jul 6;423(3):564-70. doi: 10.1016/j.bbrc.2012.06.005. Epub 2012 Jun 10.
• [35] Methylation gets SMRT. Functional insights into Rett syndrome.Dev Cell. 2003 Sep;5(3):359-60. doi: 10.1016/s1534-5807(03)00267-3.
• [36] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [37] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [38] Oestradiol and SERM treatments influence oestrogen receptor coregulator gene expression in human skeletal muscle cells. Acta Physiol (Oxf). 2009 Nov;197(3):187-96. doi: 10.1111/j.1748-1716.2009.01997.x. Epub 2009 May 6.
• [39] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [40] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [41] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [42] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [43] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [44] Induction of class II major histocompatibility complex expression in human multiple myeloma cells by retinoid. Haematologica. 2007 Jan;92(1):115-20.
• [45] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [46] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [47] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [48] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [49] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [50] Different effect of sodium butyrate on cancer and normal prostate cells. Toxicol In Vitro. 2013 Aug;27(5):1489-95. doi: 10.1016/j.tiv.2013.03.002. Epub 2013 Mar 20.
• [51] Gene expression profile and cytotoxicity of human bronchial epithelial cells exposed to crotonaldehyde. Toxicol Lett. 2010 Aug 16;197(2):113-22.
• [52] Inhibition of MAP kinase promotes the recruitment of corepressor SMRT by tamoxifen-bound estrogen receptor alpha and potentiates tamoxifen action in MCF-7 cells. Biochem Biophys Res Commun. 2010 May 28;396(2):299-303. doi: 10.1016/j.bbrc.2010.04.085. Epub 2010 Apr 18.