Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTYYB8SY)

DOT Name Olfactory receptor 10A4 (OR10A4)
Synonyms HP2; Olfactory receptor-like protein JCG5
Gene Name OR10A4
Related Disease
Diabetic retinopathy ( )
Head and neck cancer ( )
Head and neck carcinoma ( )
Neoplasm ( )
Nephropathy ( )
Acute myocardial infarction ( )
Adenocarcinoma ( )
Advanced cancer ( )
Anemia ( )
Bacterial infection ( )
Bipolar disorder ( )
Breast cancer ( )
Breast carcinoma ( )
Chronic kidney disease ( )
Classic Hodgkin lymphoma ( )
Coeliac disease ( )
Colitis ( )
Crohn disease ( )
Depression ( )
Diabetic kidney disease ( )
Fatty liver disease ( )
Head-neck squamous cell carcinoma ( )
Hepatitis C virus infection ( )
High blood pressure ( )
HIV infectious disease ( )
Huntington disease ( )
Malaria ( )
Mental disorder ( )
Non-alcoholic steatohepatitis ( )
Non-insulin dependent diabetes ( )
Pneumonia ( )
Pneumonitis ( )
Polycystic ovarian syndrome ( )
Schizophrenia ( )
Stroke ( )
Subarachnoid hemorrhage ( )
Ulcerative colitis ( )
Vascular disease ( )
Alpha thalassemia ( )
Nasopharyngeal carcinoma ( )
Obesity ( )
Essential hypertension ( )
Hyperglycemia ( )
Kaposi sarcoma ( )
Non-alcoholic fatty liver disease ( )
Parkinson disease ( )
Tuberculosis ( )
Type-1 diabetes ( )
UniProt ID
O10A4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF13853
Sequence
MMWENWTIVSEFVLVSFSALSTELQALLFLLFLTIYLVTLMGNVLIILVTIADSALQSPM
YFFLRNLSFLEIGFNLVIVPKMLGTLIIQDTTISFLGCATQMYFFFFFGAAECCLLATMA
YDRYVAICDPLHYPVIMGHISCAQLAAASWFSGFSVATVQTTWIFSFPFCGPNRVNHFFC
DSPPVIALVCADTSVFELEALTATVLFILFPFLLILGSYVRILSTIFRMPSAEGKHQAFS
TCSAHLLVVSLFYSTAILTYFRPQSSASSESKKLLSLSSTVVTPMLNPIIYSSRNKEVKA
ALKRLIHRTLGSQKL
Function Odorant receptor (Potential). May be involved in taste perception.
Tissue Specificity Expressed in the tongue.
KEGG Pathway
Olfactory transduction (hsa04740 )
Reactome Pathway
Expression and translocation of olfactory receptors (R-HSA-9752946 )

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Diabetic retinopathy DISHGUJM Definitive Genetic Variation [1]
Head and neck cancer DISBPSQZ Definitive Biomarker [2]
Head and neck carcinoma DISOU1DS Definitive Biomarker [2]
Neoplasm DISZKGEW Definitive Biomarker [3]
Nephropathy DISXWP4P Definitive Genetic Variation [4]
Acute myocardial infarction DISE3HTG Strong Biomarker [5]
Adenocarcinoma DIS3IHTY Strong Genetic Variation [6]
Advanced cancer DISAT1Z9 Strong Biomarker [7]
Anemia DISTVL0C Strong Genetic Variation [8]
Bacterial infection DIS5QJ9S Strong Biomarker [9]
Bipolar disorder DISAM7J2 Strong Genetic Variation [10]
Breast cancer DIS7DPX1 Strong Genetic Variation [11]
Breast carcinoma DIS2UE88 Strong Genetic Variation [11]
Chronic kidney disease DISW82R7 Strong Biomarker [12]
Classic Hodgkin lymphoma DISV1LU6 Strong Altered Expression [13]
Coeliac disease DISIY60C Strong Biomarker [14]
Colitis DISAF7DD Strong Biomarker [15]
Crohn disease DIS2C5Q8 Strong Biomarker [16]
Depression DIS3XJ69 Strong Genetic Variation [17]
Diabetic kidney disease DISJMWEY Strong Genetic Variation [18]
Fatty liver disease DIS485QZ Strong Biomarker [19]
Head-neck squamous cell carcinoma DISF7P24 Strong Genetic Variation [20]
Hepatitis C virus infection DISQ0M8R Strong Genetic Variation [21]
High blood pressure DISY2OHH Strong Biomarker [22]
HIV infectious disease DISO97HC Strong Biomarker [23]
Huntington disease DISQPLA4 Strong Altered Expression [13]
Malaria DISQ9Y50 Strong Biomarker [24]
Mental disorder DIS3J5R8 Strong Genetic Variation [17]
Non-alcoholic steatohepatitis DIST4788 Strong Genetic Variation [25]
Non-insulin dependent diabetes DISK1O5Z Strong Genetic Variation [26]
Pneumonia DIS8EF3M Strong Biomarker [27]
Pneumonitis DIS88E0K Strong Biomarker [27]
Polycystic ovarian syndrome DISZ2BNG Strong Genetic Variation [28]
Schizophrenia DISSRV2N Strong Biomarker [29]
Stroke DISX6UHX Strong Genetic Variation [30]
Subarachnoid hemorrhage DISI7I8Y Strong Genetic Variation [31]
Ulcerative colitis DIS8K27O Strong Biomarker [16]
Vascular disease DISVS67S Strong Genetic Variation [32]
Alpha thalassemia DIS5XGK0 moderate Genetic Variation [33]
Nasopharyngeal carcinoma DISAOTQ0 moderate Genetic Variation [34]
Obesity DIS47Y1K moderate Biomarker [22]
Essential hypertension DIS7WI98 Limited Biomarker [35]
Hyperglycemia DIS0BZB5 Limited Genetic Variation [36]
Kaposi sarcoma DISC1H1Z Limited Genetic Variation [37]
Non-alcoholic fatty liver disease DISDG1NL Limited Genetic Variation [19]
Parkinson disease DISQVHKL Limited Genetic Variation [38]
Tuberculosis DIS2YIMD Limited Biomarker [39]
Type-1 diabetes DIS7HLUB Limited Genetic Variation [40]
------------------------------------------------------------------------------------
⏷ Show the Full List of 48 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Olfactory receptor 10A4 (OR10A4). [41]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Olfactory receptor 10A4 (OR10A4). [42]
------------------------------------------------------------------------------------

References

1 Haptoglobin phenotypes in diabetes mellitus and diabetic retinopathy.Hum Hered. 1991;41(5):347-50. doi: 10.1159/000154023.
2 Functional and T cell receptor gene usage analysis of cytotoxic T lymphocytes in fresh tumor-infiltrating lymphocytes from human head and neck cancer.Jpn J Cancer Res. 1995 May;86(5):477-83. doi: 10.1111/j.1349-7006.1995.tb03081.x.
3 Site-specific conjugation of recognition tags to trastuzumab for peptide nucleic acid-mediated radionuclide HER2 pretargeting.Biomaterials. 2019 May;203:73-85. doi: 10.1016/j.biomaterials.2019.02.012. Epub 2019 Feb 14.
4 Association between haptoglobin gene variants and diabetic nephropathy: haptoglobin polymorphism in nephropathy susceptibility.Nephron Exp Nephrol. 2007;105(3):e75-9. doi: 10.1159/000098563. Epub 2007 Jan 12.
5 Association of haptoglobin phenotype with incident acute myocardial infarction in Chinese patients with type 2 diabetes.Cardiovasc Diabetol. 2019 May 30;18(1):65. doi: 10.1186/s12933-019-0867-4.
6 Haptoglobin groups and lung cancer.Hum Hered. 1986;36(4):258-60. doi: 10.1159/000153638.
7 Haptoglobin groups in ovarian carcinoma.Hum Hered. 1988;38(3):180-2. doi: 10.1159/000153782.
8 Seasonal childhood anaemia in West Africa is associated with the haptoglobin 2-2 genotype.PLoS Med. 2006 May;3(5):e172. doi: 10.1371/journal.pmed.0030172. Epub 2006 May 2.
9 Phenotypic polymorphism of haptoglobin: a novel risk factor for the development of infection in liver cirrhosis.Hum Immunol. 2011 Apr;72(4):348-54. doi: 10.1016/j.humimm.2011.01.008. Epub 2011 Jan 21.
10 Differential expression of disrupted-in-schizophrenia (DISC1) in bipolar disorder.Biol Psychiatry. 2006 Nov 1;60(9):929-35. doi: 10.1016/j.biopsych.2006.03.032. Epub 2006 Jun 30.
11 Haptoglobin polymorphism in breast cancer patients form Jordan.Clin Chim Acta. 2004 Mar;341(1-2):17-21. doi: 10.1016/j.cccn.2003.10.032.
12 Effects of carnitine on oxidative stress response to intravenous iron administration to patients with CKD: impact of haptoglobin phenotype.BMC Nephrol. 2015 Aug 13;16:135. doi: 10.1186/s12882-015-0119-0.
13 Interaction between the Haptoglobin 2 Phenotype and Diabetes Mellitus on Systolic Pulmonary Arterial Pressure and Nitric Oxide Bioavailability in Hemodialysis Patients.J Diabetes Res. 2015;2015:613860. doi: 10.1155/2015/613860. Epub 2015 Jun 11.
14 Haptoglobin polymorphism: a novel genetic risk factor for celiac disease development and its clinical manifestations.Clin Chem. 2008 Apr;54(4):697-704. doi: 10.1373/clinchem.2007.098780. Epub 2008 Feb 7.
15 Peptide Hp(2-20) accelerates healing of TNBS-induced colitis in the rat.United European Gastroenterol J. 2018 Nov;6(9):1428-1436. doi: 10.1177/2050640618793564. Epub 2018 Aug 24.
16 Effects of haptoglobin polymorphisms and deficiency on susceptibility to inflammatory bowel disease and on severity of murine colitis.Gut. 2012 Apr;61(4):528-34. doi: 10.1136/gut.2011.240978. Epub 2011 Jun 27.
17 Haptoglobin types and unipolar depression.Hum Hered. 1984;34(2):65-8. doi: 10.1159/000153438.
18 The Iron-Klotho-VDR Axis Is a Major Determinant of Proximal Convoluted Tubule Injury in Haptoglobin 2-2 Genotype Diabetic Nephropathy Patients and Mice.J Diabetes Res. 2018 Sep 3;2018:7163652. doi: 10.1155/2018/7163652. eCollection 2018.
19 Haptoglobin 2 Allele is Associated With Histologic Response to Vitamin E in Subjects With Nonalcoholic Steatohepatitis.J Clin Gastroenterol. 2019 Nov/Dec;53(10):750-758. doi: 10.1097/MCG.0000000000001142.
20 The prognostic utility of haptoglobin genotypes in squamous cell carcinoma of the head and neck.Clin Chem Lab Med. 2009;47(10):1277-83. doi: 10.1515/CCLM.2009.275.
21 Association between Cys282Tyr missense mutation and haptoglobin phenotype polymorphism in patients with chronic hepatitis C.Eur J Gastroenterol Hepatol. 2001 Sep;13(9):1077-81. doi: 10.1097/00042737-200109000-00014.
22 Haptoglobin phenotypes with weak antioxidant capacity increase risk factors of cardiovascular disease in Ghanaian HIV-infected patients on highly active antiretroviral therapy.Trop Med Int Health. 2019 Jun;24(6):766-774. doi: 10.1111/tmi.13229. Epub 2019 Mar 21.
23 Haptoglobin polymorphism in a HIV-1 seropositive Brazilian population.J Clin Pathol. 2006 May;59(5):550-3. doi: 10.1136/jcp.2005.027375.
24 Haptoglobin phenotypes and iron status in children living in a malaria endemic area of Kenyan coast.Acta Trop. 2013 May;126(2):127-31. doi: 10.1016/j.actatropica.2013.02.004. Epub 2013 Feb 13.
25 Haptoglobin 2-2 Genotype is Associated with More Advanced Disease in Subjects with Non-Alcoholic Steatohepatitis: A Retrospective Study.Adv Ther. 2019 Apr;36(4):880-895. doi: 10.1007/s12325-019-00902-z. Epub 2019 Feb 28.
26 Haptoglobin 2-2 genotype and the risk of coronary artery disease in the Diabetes Control and Complications Trial/Epidemiology of Diabetes Interventions and Complications study (DCCT/EDIC).J Diabetes Complications. 2016 Nov-Dec;30(8):1577-1584. doi: 10.1016/j.jdiacomp.2016.07.014. Epub 2016 Jul 25.
27 Haptoglobin-2 variant increases susceptibility to acute respiratory distress syndrome during sepsis.JCI Insight. 2019 Nov 1;4(21):e131206. doi: 10.1172/jci.insight.131206.
28 Haptoglobin levels, but not Hp1-Hp2 polymorphism, are associated with polycystic ovary syndrome.J Assist Reprod Genet. 2017 Dec;34(12):1691-1698. doi: 10.1007/s10815-017-1030-3. Epub 2017 Sep 13.
29 Upregulation of the Intestinal Paracellular Pathway with Breakdown of Tight and Adherens Junctions in Deficit Schizophrenia.Mol Neurobiol. 2019 Oct;56(10):7056-7073. doi: 10.1007/s12035-019-1578-2. Epub 2019 Apr 10.
30 Haptoglobin genotype and cerebrovascular disease incidence in type 1 diabetes.Diab Vasc Dis Res. 2014 Sep;11(5):335-42. doi: 10.1177/1479164114539713. Epub 2014 Jul 3.
31 Study of Correlation Between Hp 1 Expression of Haptoglobin 2-1 and Clinical Course in Aneurysmal Subarachnoid Hemorrhage.World Neurosurg. 2018 Sep;117:e221-e227. doi: 10.1016/j.wneu.2018.06.003. Epub 2018 Jun 12.
32 Haptoglobin Genotype Is a Determinant of Hemoglobin Adducts and Vitamin E Content in HDL.J Diabetes Res. 2018 May 20;2018:6125420. doi: 10.1155/2018/6125420. eCollection 2018.
33 Epistasis between the haptoglobin common variant and +thalassemia influences risk of severe malaria in Kenyan children.Blood. 2014 Mar 27;123(13):2008-16. doi: 10.1182/blood-2013-10-533489. Epub 2014 Jan 29.
34 Haptoglobin genotypes in nasopharyngeal carcinoma.Int J Biol Markers. 2009 Jan-Mar;24(1):32-7. doi: 10.5301/jbm.2009.3305.
35 Haptoglobin polymorphism, a genetic risk factor in coronary artery bypass surgery.Atherosclerosis. 1997 Jul 25;132(2):215-9. doi: 10.1016/s0021-9150(97)00089-0.
36 The Risk of Coronary Heart Disease Associated With Glycosylated Hemoglobin of 6.5% or Greater Is Pronounced in the Haptoglobin 2-2 Genotype.J Am Coll Cardiol. 2015 Oct 20;66(16):1791-1799. doi: 10.1016/j.jacc.2015.07.076.
37 Association of haptoglobin phenotypes with the development of Kaposi's sarcoma in HIV patients.Arch Dermatol Res. 2011 Dec;303(10):763-9. doi: 10.1007/s00403-011-1161-9. Epub 2011 Jul 12.
38 The functional polymorphism of the hemoglobin-binding protein haptoglobin influences susceptibility to idiopathic Parkinson's disease.Am J Med Genet B Neuropsychiatr Genet. 2008 Mar 5;147B(2):216-22. doi: 10.1002/ajmg.b.30593.
39 Haptoglobin polymorphism and mortality in patients with tuberculosis.Int J Tuberc Lung Dis. 2000 Aug;4(8):771-5.
40 The haptoglobin 2-2 genotype is associated with cardiac autonomic neuropathy in type 1 diabetes: the RETRO HDLc study.Acta Diabetol. 2020 Mar;57(3):271-278. doi: 10.1007/s00592-019-01422-6. Epub 2019 Sep 16.
41 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
42 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.