Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZPJ3GX)

• DOT Name: Receptor-type tyrosine-protein phosphatase delta (PTPRD)
• Synonyms: Protein-tyrosine phosphatase delta; R-PTP-delta; EC 3.1.3.48
• Gene Name: PTPRD
• Related Disease:
  Neuroblastoma
  Advanced cancer
  Atopic dermatitis
  B-cell lymphoma
  Breast cancer
  Breast neoplasm
  Chromosomal disorder
  Clear cell renal carcinoma
  Colorectal carcinoma
  Endometrial cancer
  Endometriosis
  Epilepsy
  Esophageal squamous cell carcinoma
  Ewing sarcoma
  Gastric adenocarcinoma
  Glioblastoma multiforme
  Hepatocellular carcinoma
  High blood pressure
  Hyperinsulinemia
  Laryngeal squamous cell carcinoma
  Lung cancer
  Lung carcinoma
  Major depressive disorder
  Mood disorder
  Nephrotic syndrome
  Non-alcoholic fatty liver disease
  Squamous cell carcinoma
  Type-1/2 diabetes
  Asthma
  Attention deficit hyperactivity disorder
  Colon adenocarcinoma
  Endometrial carcinoma
  Narcolepsy
  Colorectal neoplasm
  Melanoma
  Non-small-cell lung cancer
  Small-cell lung cancer
  Acute myelogenous leukaemia
  Breast carcinoma
  Coronary heart disease
  Cutaneous squamous cell carcinoma
  Gout
  MALT lymphoma
  Neoplasm
  Non-insulin dependent diabetes
• UniProt ID: PTPRD_HUMAN
• PDB ID: 1X5Z; 2DLH; 2YD6; 2YD7; 4RCA; 5WY8; 5XNP; 6X3A
• EC Number: 3.1.3.48
• Pfam ID: PF00041 ; PF07679 ; PF13927 ; PF00102
• Sequence:
  MVHVARLLLLLLTFFLRTDAETPPRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKK
  GKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLREDQ
  IPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRS
  ESIGGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRELREVRRVPPRFSI
  PPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPEDDMPIGRNVLELNDVRQSANY
  TCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTWDSGNPEPVSYYIIQHKP
  KNSEELYKEIDGVATTRYSVAGLSPYSDYEFRVVAVNNIGRGPPSEPVLTQTSEQAPSSA
  PRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIG
  NLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSWTPPR
  SDTIANYELVYKDGEHGEEQRITIEPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEI
  SARTMQSKPSAPPQDISCTSPSSTSILVSWQPPPVEKQNGIITEYSIKYTAVDGEDDKPH
  EILGIPSDTTKYLLEQLEKWTEYRITVTAHTDVGPGPESLSVLIRTNEDVPSGPPRKVEV
  EAVNSTSVKVSWRSPVPNKQHGQIRGYQVHYVRMENGEPKGQPMLKDVMLADAQWEFDDT
  TEHDMIISGLQPETSYSLTVTAYTTKGDGARSKPKLVSTTGAVPGKPRLVINHTQMNTAL
  IQWHPPVDTFGPLQGYRLKFGRKDMEPLTTLEFSEKEDHFTATDIHKGASYVFRLSARNK
  VGFGEEMVKEISIPEEVPTGFPQNLHSEGTTSTSVQLSWQPPVLAERNGIITKYTLLYRD
  INIPLLPMEQLIVPADTTMTLTGLKPDTTYDVKVRAHTSKGPGPYSPSVQFRTLPVDQVF
  AKNFHVKAVMKTSVLLSWEIPENYNSAMPFKILYDDGKMVEEVDGRATQKLIVNLKPEKS
  YSFVLTNRGNSAGGLQHRVTAKTAPDVLRTKPAFIGKTNLDGMITVQLPEVPANENIKGY
  YIIIVPLKKSRGKFIKPWESPDEMELDELLKEISRKRRSIRYGREVELKPYIAAHFDVLP
  TEFTLGDDKHYGGFTNKQLQSGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPI
  TDEEEGLIWVVGPVLAVVFIICIVIAILLYKRKRAESDSRKSSIPNNKEIPSHHPTDPVE
  LRRLNFQTPGMASHPPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVN
  KPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFW
  RMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETHGLVQVTLLDTVELATYCVRTFAL
  YKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRT
  GCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEV
  PARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMP
  YESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIV
  VMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTV
  RQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIV
  LERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFSYRAALEYLGSFDHYAT
• Function: Can bidirectionally induce pre- and post-synaptic differentiation of neurons by mediating interaction with IL1RAP and IL1RAPL1 trans-synaptically. Involved in pre-synaptic differentiation through interaction with SLITRK2.
• KEGG Pathway: Cell adhesion molecules (hsa04514)
• Reactome Pathway:
  Synaptic adhesion-like molecules (R-HSA-8849932)
  Receptor-type tyrosine-protein phosphatases (R-HSA-388844)

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Neuroblastoma	DISVZBI4	Definitive	Genetic Variation	[1]
Advanced cancer	DISAT1Z9	Strong	Posttranslational Modification	[2]
Atopic dermatitis	DISTCP41	Strong	Genetic Variation	[3]
B-cell lymphoma	DISIH1YQ	Strong	Biomarker	[4]
Breast cancer	DIS7DPX1	Strong	Biomarker	[5]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[6]
Chromosomal disorder	DISM5BB5	Strong	Altered Expression	[7]
Clear cell renal carcinoma	DISBXRFJ	Strong	Genetic Variation	[8]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[9]
Endometrial cancer	DISW0LMR	Strong	Biomarker	[10]
Endometriosis	DISX1AG8	Strong	Biomarker	[10]
Epilepsy	DISBB28L	Strong	Genetic Variation	[11]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[12]
Ewing sarcoma	DISQYLV3	Strong	Genetic Variation	[13]
Gastric adenocarcinoma	DISWWLTC	Strong	Biomarker	[14]
Glioblastoma multiforme	DISK8246	Strong	Genetic Variation	[15]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[16]
High blood pressure	DISY2OHH	Strong	Biomarker	[17]
Hyperinsulinemia	DISIDWT6	Strong	Genetic Variation	[17]
Laryngeal squamous cell carcinoma	DIS9UUVF	Strong	Posttranslational Modification	[2]
Lung cancer	DISCM4YA	Strong	Biomarker	[18]
Lung carcinoma	DISTR26C	Strong	Biomarker	[18]
Major depressive disorder	DIS4CL3X	Strong	Genetic Variation	[19]
Mood disorder	DISLVMWO	Strong	Genetic Variation	[19]
Nephrotic syndrome	DISSPSC2	Strong	Genetic Variation	[20]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Genetic Variation	[21]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[22]
Type-1/2 diabetes	DISIUHAP	Strong	Genetic Variation	[17]
Asthma	DISW9QNS	moderate	Biomarker	[23]
Attention deficit hyperactivity disorder	DISL8MX9	moderate	Biomarker	[24]
Colon adenocarcinoma	DISDRE0J	moderate	Genetic Variation	[25]
Endometrial carcinoma	DISXR5CY	moderate	Biomarker	[10]
Narcolepsy	DISLCNLI	moderate	Genetic Variation	[26]
Colorectal neoplasm	DISR1UCN	Disputed	Biomarker	[9]
Melanoma	DIS1RRCY	Disputed	Biomarker	[25]
Non-small-cell lung cancer	DIS5Y6R9	Disputed	Genetic Variation	[27]
Small-cell lung cancer	DISK3LZD	Disputed	Genetic Variation	[27]
Acute myelogenous leukaemia	DISCSPTN	Limited	Genetic Variation	[28]
Breast carcinoma	DIS2UE88	Limited	Genetic Variation	[29]
Coronary heart disease	DIS5OIP1	Limited	Biomarker	[30]
Cutaneous squamous cell carcinoma	DIS3LXUG	Limited	Genetic Variation	[31]
Gout	DISHC0U7	Limited	Genetic Variation	[32]
MALT lymphoma	DIS1AVVE	Limited	Altered Expression	[33]
Neoplasm	DISZKGEW	Limited	Posttranslational Modification	[2]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Biomarker	[34]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Receptor-type tyrosine-protein phosphatase delta (PTPRD).	[35]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Receptor-type tyrosine-protein phosphatase delta (PTPRD).	[48]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Receptor-type tyrosine-protein phosphatase delta (PTPRD).	[36]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Receptor-type tyrosine-protein phosphatase delta (PTPRD).	[37]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Receptor-type tyrosine-protein phosphatase delta (PTPRD).	[38]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Receptor-type tyrosine-protein phosphatase delta (PTPRD).	[39]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Receptor-type tyrosine-protein phosphatase delta (PTPRD).	[40]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Receptor-type tyrosine-protein phosphatase delta (PTPRD).	[41]
Marinol	DM70IK5	Approved	Marinol increases the expression of Receptor-type tyrosine-protein phosphatase delta (PTPRD).	[42]
Irinotecan	DMP6SC2	Approved	Irinotecan increases the expression of Receptor-type tyrosine-protein phosphatase delta (PTPRD).	[43]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Receptor-type tyrosine-protein phosphatase delta (PTPRD).	[44]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Receptor-type tyrosine-protein phosphatase delta (PTPRD).	[45]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Receptor-type tyrosine-protein phosphatase delta (PTPRD).	[46]
Geldanamycin	DMS7TC5	Discontinued in Phase 2	Geldanamycin increases the expression of Receptor-type tyrosine-protein phosphatase delta (PTPRD).	[47]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Receptor-type tyrosine-protein phosphatase delta (PTPRD).	[49]

References

• [1] Aberrant splicing of the PTPRD gene mimics microdeletions identified at this locus in neuroblastomas.Genes Chromosomes Cancer. 2008 Mar;47(3):197-202. doi: 10.1002/gcc.20521.
• [2] Recurrent epigenetic silencing of the PTPRD tumor suppressor in laryngeal squamous cell carcinoma.Tumour Biol. 2017 Mar;39(3):1010428317691427. doi: 10.1177/1010428317691427.
• [3] The effect of autophagy-enhancing peptide in moisturizer on atopic dermatitis: a randomized controlled trial.J Dermatolog Treat. 2019 Sep;30(6):558-564. doi: 10.1080/09546634.2018.1544407. Epub 2018 Dec 2.
• [4] The mutational pattern of primary lymphoma of the central nervous system determined by whole-exome sequencing.Leukemia. 2015 Mar;29(3):677-85. doi: 10.1038/leu.2014.264. Epub 2014 Sep 5.
• [5] Increased metastasis with loss of E2F2 in Myc-driven tumors.Oncotarget. 2015 Nov 10;6(35):38210-24. doi: 10.18632/oncotarget.5690.
• [6] Convergence of mutation and epigenetic alterations identifies common genes in cancer that predict for poor prognosis.PLoS Med. 2008 May 27;5(5):e114. doi: 10.1371/journal.pmed.0050114.
• [7] An integrative CGH, MSI and candidate genes methylation analysis of colorectal tumors.PLoS One. 2014 Jan 27;9(1):e82185. doi: 10.1371/journal.pone.0082185. eCollection 2014.
• [8] Polymorphism in protein tyrosine phosphatase receptor delta is associated with the risk of clear cell renal cell carcinoma.Gene. 2013 Jan 1;512(1):64-9. doi: 10.1016/j.gene.2012.09.094. Epub 2012 Oct 13.
• [9] Genomic and epigenomic integration identifies a prognostic signature in colon cancer.Clin Cancer Res. 2011 Mar 15;17(6):1535-45. doi: 10.1158/1078-0432.CCR-10-2509. Epub 2011 Jan 28.
• [10] Genetic overlap between endometriosis and endometrial cancer: evidence from cross-disease genetic correlation and GWAS meta-analyses.Cancer Med. 2018 May;7(5):1978-1987. doi: 10.1002/cam4.1445. Epub 2018 Apr 2.
• [11] A genome-wide association study and biological pathway analysis of epilepsy prognosis in a prospective cohort of newly treated epilepsy.Hum Mol Genet. 2014 Jan 1;23(1):247-58. doi: 10.1093/hmg/ddt403. Epub 2013 Aug 19.
• [12] Characterization of gene rearrangements resulted from genomic structural aberrations in human esophageal squamous cell carcinoma KYSE150 cells.Gene. 2013 Jan 15;513(1):196-201. doi: 10.1016/j.gene.2012.09.091. Epub 2012 Sep 28.
• [13] Novel secondary somatic mutations in Ewing's sarcoma and desmoplastic small round cell tumors.PLoS One. 2014 Aug 13;9(8):e93676. doi: 10.1371/journal.pone.0093676. eCollection 2014.
• [14] Reduced expression of PTPRD correlates with poor prognosis in gastric adenocarcinoma.PLoS One. 2014 Nov 20;9(11):e113754. doi: 10.1371/journal.pone.0113754. eCollection 2014.
• [15] Germline mutations and new copy number variants among 40 pediatric cancer patients suspected for genetic predisposition.Clin Genet. 2019 Oct;96(4):359-365. doi: 10.1111/cge.13600. Epub 2019 Jul 15.
• [16] PTPRD is homozygously deleted and epigenetically downregulated in human hepatocellular carcinomas.OMICS. 2015 Apr;19(4):220-9. doi: 10.1089/omi.2015.0010.
• [17] Replication of genome-wide association signals of type 2 diabetes in Han Chinese in a prospective cohort.Clin Endocrinol (Oxf). 2012 Mar;76(3):365-72. doi: 10.1111/j.1365-2265.2011.04175.x.
• [18] A catalog of genes homozygously deleted in human lung cancer and the candidacy of PTPRD as a tumor suppressor gene.Genes Chromosomes Cancer. 2010 Apr;49(4):342-52. doi: 10.1002/gcc.20746.
• [19] Analysis of 23andMe antidepressant efficacy survey data: implication of circadian rhythm and neuroplasticity in bupropion response.Transl Psychiatry. 2016 Sep 13;6(9):e889. doi: 10.1038/tp.2016.171.
• [20] Genetic Identification of Two Novel Loci Associated with Steroid-Sensitive Nephrotic Syndrome.J Am Soc Nephrol. 2019 Aug;30(8):1375-1384. doi: 10.1681/ASN.2018101054. Epub 2019 Jul 1.
• [21] GWAS and enrichment analyses of non-alcoholic fatty liver disease identify new trait-associated genes and pathways across eMERGE Network.BMC Med. 2019 Jul 17;17(1):135. doi: 10.1186/s12916-019-1364-z.
• [22] Allelic imbalances and microdeletions affecting the PTPRD gene in cutaneous squamous cell carcinomas detected using single nucleotide polymorphism microarray analysis.Genes Chromosomes Cancer. 2007 Jul;46(7):661-9. doi: 10.1002/gcc.20447.
• [23] Analyses of shared genetic factors between asthma and obesity in children.J Allergy Clin Immunol. 2010 Sep;126(3):631-7.e1-8. doi: 10.1016/j.jaci.2010.06.030.
• [24] Rare structural variants found in attention-deficit hyperactivity disorder are preferentially associated with neurodevelopmental genes.Mol Psychiatry. 2010 Jun;15(6):637-46. doi: 10.1038/mp.2009.57. Epub 2009 Jun 23.
• [25] Mutational and functional analysis of the tumor-suppressor PTPRD in human melanoma.Hum Mutat. 2014 Nov;35(11):1301-10. doi: 10.1002/humu.22630. Epub 2014 Sep 10.
• [26] Genome-wide association studies of sleep disorders.Chest. 2011 Feb;139(2):446-452. doi: 10.1378/chest.10-1313.
• [27] Homozygous deletions and chromosome amplifications in human lung carcinomas revealed by single nucleotide polymorphism array analysis.Cancer Res. 2005 Jul 1;65(13):5561-70. doi: 10.1158/0008-5472.CAN-04-4603.
• [28] Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
• [29] Association analysis identifies 65 new breast cancer risk loci.Nature. 2017 Nov 2;551(7678):92-94. doi: 10.1038/nature24284. Epub 2017 Oct 23.
• [30] Large scale association analysis identifies three susceptibility loci for coronary artery disease.PLoS One. 2011;6(12):e29427. doi: 10.1371/journal.pone.0029427. Epub 2011 Dec 27.
• [31] Metastatic cutaneous squamous cell carcinoma shows frequent deletion in the protein tyrosine phosphatase receptor Type D gene.Int J Cancer. 2012 Aug 1;131(3):E216-26. doi: 10.1002/ijc.27333. Epub 2011 Dec 21.
• [32] Gout and type 2 diabetes have a mutual inter-dependent effect on genetic risk factors and higher incidences.Rheumatology (Oxford). 2012 Apr;51(4):715-20. doi: 10.1093/rheumatology/ker373. Epub 2011 Dec 16.
• [33] The genetics of nodal marginal zone lymphoma.Blood. 2016 Sep 8;128(10):1362-73. doi: 10.1182/blood-2016-02-696757. Epub 2016 Jun 22.
• [34] Positive Association Between Type 2 Diabetes Risk Alleles Near CDKAL1 and Reduced Birthweight in Chinese Han Individuals.Chin Med J (Engl). 2015 Jul 20;128(14):1873-8. doi: 10.4103/0366-6999.160489.
• [35] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [36] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [37] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [38] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [39] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [40] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [41] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [42] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [43] In vitro and in vivo irinotecan-induced changes in expression profiles of cell cycle and apoptosis-associated genes in acute myeloid leukemia cells. Mol Cancer Ther. 2005 Jun;4(6):885-900.
• [44] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [45] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [46] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [47] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [48] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [49] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.