Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT00THXS)

• DOT Name: Elongation factor 1-alpha 1 (EEF1A1)
• Synonyms: EF-1-alpha-1; EC 3.6.5.-; Elongation factor Tu; EF-Tu; Eukaryotic elongation factor 1 A-1; eEF1A-1; Leukocyte receptor cluster member 7
• Gene Name: EEF1A1
• Related Disease:
  Acute myelogenous leukaemia
  Alzheimer disease
  Breast cancer
  Breast carcinoma
  Cardiovascular disease
  Cerebral infarction
  Cervical Intraepithelial neoplasia
  Charcot marie tooth disease
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Colorectal neoplasm
  Ductal carcinoma
  Gastric cancer
  Gastric neoplasm
  Germ cell tumor
  Hepatocellular carcinoma
  Hereditary diffuse gastric adenocarcinoma
  Inflammatory bowel disease
  Knee osteoarthritis
  Lung cancer
  Lyme disease
  Melanoma
  Metastatic prostate carcinoma
  Non-alcoholic fatty liver disease
  Pancreatic cancer
  Pneumococcal infection
  Prostate adenocarcinoma
  Prostate cancer
  Prostate carcinoma
  Prostate neoplasm
  Seminoma
  Tuberculosis
  Clear cell renal carcinoma
  Epithelial ovarian cancer
  Lung carcinoma
  Ovarian cancer
  Ovarian neoplasm
  Renal cell carcinoma
  Advanced cancer
  Carcinoma
  Colon adenocarcinoma
  Lewy body dementia
  Neoplasm
  Osteoarthritis
  Parkinson disease
  Undifferentiated carcinoma
• UniProt ID: EF1A1_HUMAN
• PDB ID: 3C5J; 6ZMO; 8G60; 8G6J
• EC Number: 3.6.5.-
• Pfam ID: PF00009 ; PF03144 ; PF03143
• Sequence:
  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL
  DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV
  GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKK
  IGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTR
  PTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALS
  EALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPV
  LDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPP
  LGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK
• Function: Translation elongation factor that catalyzes the GTP-dependent binding of aminoacyl-tRNA (aa-tRNA) to the A-site of ribosomes during the elongation phase of protein synthesis. Base pairing between the mRNA codon and the aa-tRNA anticodon promotes GTP hydrolysis, releasing the aa-tRNA from EEF1A1 and allowing its accommodation into the ribosome. The growing protein chain is subsequently transferred from the P-site peptidyl tRNA to the A-site aa-tRNA, extending it by one amino acid through ribosome-catalyzed peptide bond formation. Also plays a role in the positive regulation of IFNG transcription in T-helper 1 cells as part of an IFNG promoter-binding complex with TXK and PARP1 ; (Microbial infection) Required for the translation of viral proteins and viral replication during human coronavirus SARS-CoV-2 infection.
• KEGG Pathway:
  Nucleocytoplasmic transport (hsa03013)
  Legionellosis (hsa05134)
  Leishmaniasis (hsa05140)
• Reactome Pathway:
  Peptide chain elongation (R-HSA-156902)
  HSF1 activation (R-HSA-3371511)
  Neutrophil degranulation (R-HSA-6798695)
  Protein methylation (R-HSA-8876725)
  Chaperone Mediated Autophagy (R-HSA-9613829)
  SARS-CoV-1 modulates host translation machinery (R-HSA-9735869)
  Eukaryotic Translation Elongation (R-HSA-156842)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute myelogenous leukaemia	DISCSPTN	Strong	Altered Expression	[1]
Alzheimer disease	DISF8S70	Strong	Biomarker	[2]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[3]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[3]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[4]
Cerebral infarction	DISR1WNP	Strong	Altered Expression	[4]
Cervical Intraepithelial neoplasia	DISXP757	Strong	Altered Expression	[5]
Charcot marie tooth disease	DIS3BT2L	Strong	Genetic Variation	[6]
Colon cancer	DISVC52G	Strong	Altered Expression	[7]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[7]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[8]
Colorectal neoplasm	DISR1UCN	Strong	Genetic Variation	[9]
Ductal carcinoma	DIS15EA5	Strong	Biomarker	[3]
Gastric cancer	DISXGOUK	Strong	Biomarker	[10]
Gastric neoplasm	DISOKN4Y	Strong	Biomarker	[10]
Germ cell tumor	DIS62070	Strong	Altered Expression	[11]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[12]
Hereditary diffuse gastric adenocarcinoma	DISUIBYS	Strong	Biomarker	[10]
Inflammatory bowel disease	DISGN23E	Strong	Genetic Variation	[9]
Knee osteoarthritis	DISLSNBJ	Strong	Biomarker	[13]
Lung cancer	DISCM4YA	Strong	Altered Expression	[14]
Lyme disease	DISO70G5	Strong	Biomarker	[15]
Melanoma	DIS1RRCY	Strong	Biomarker	[16]
Metastatic prostate carcinoma	DISVBEZ9	Strong	Altered Expression	[17]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Biomarker	[18]
Pancreatic cancer	DISJC981	Strong	Biomarker	[19]
Pneumococcal infection	DIS6SXQD	Strong	Biomarker	[20]
Prostate adenocarcinoma	DISBZYU8	Strong	Biomarker	[21]
Prostate cancer	DISF190Y	Strong	Biomarker	[22]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[22]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[23]
Seminoma	DIS3J8LJ	Strong	Altered Expression	[11]
Tuberculosis	DIS2YIMD	Strong	Biomarker	[24]
Clear cell renal carcinoma	DISBXRFJ	moderate	Biomarker	[25]
Epithelial ovarian cancer	DIS56MH2	moderate	Biomarker	[26]
Lung carcinoma	DISTR26C	moderate	Biomarker	[27]
Ovarian cancer	DISZJHAP	moderate	Biomarker	[26]
Ovarian neoplasm	DISEAFTY	moderate	Biomarker	[26]
Renal cell carcinoma	DISQZ2X8	moderate	Biomarker	[25]
Advanced cancer	DISAT1Z9	Limited	Altered Expression	[28]
Carcinoma	DISH9F1N	Limited	Biomarker	[29]
Colon adenocarcinoma	DISDRE0J	Limited	Altered Expression	[7]
Lewy body dementia	DISAE66J	Limited	Biomarker	[30]
Neoplasm	DISZKGEW	Limited	Altered Expression	[3]
Osteoarthritis	DIS05URM	Limited	Biomarker	[31]
Parkinson disease	DISQVHKL	Limited	Altered Expression	[32]
Undifferentiated carcinoma	DISIAZST	Limited	Biomarker	[29]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Methotrexate	DM2TEOL	Approved	Elongation factor 1-alpha 1 (EEF1A1) decreases the response to substance of Methotrexate.	[58]
Plitidepsin	DMJ8AUE	Phase 3	Elongation factor 1-alpha 1 (EEF1A1) increases the response to substance of Plitidepsin.	[59]

24 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Elongation factor 1-alpha 1 (EEF1A1).	[33]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Elongation factor 1-alpha 1 (EEF1A1).	[34]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Elongation factor 1-alpha 1 (EEF1A1).	[35]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Elongation factor 1-alpha 1 (EEF1A1).	[36]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Elongation factor 1-alpha 1 (EEF1A1).	[37]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Elongation factor 1-alpha 1 (EEF1A1).	[38]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Elongation factor 1-alpha 1 (EEF1A1).	[39]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Elongation factor 1-alpha 1 (EEF1A1).	[40]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Elongation factor 1-alpha 1 (EEF1A1).	[41]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Elongation factor 1-alpha 1 (EEF1A1).	[42]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Elongation factor 1-alpha 1 (EEF1A1).	[43]
Aspirin	DM672AH	Approved	Aspirin increases the expression of Elongation factor 1-alpha 1 (EEF1A1).	[44]
Menthol	DMG2KW7	Approved	Menthol decreases the expression of Elongation factor 1-alpha 1 (EEF1A1).	[45]
Azacitidine	DMTA5OE	Approved	Azacitidine decreases the expression of Elongation factor 1-alpha 1 (EEF1A1).	[46]
Dopamine	DMPGUCF	Approved	Dopamine increases the expression of Elongation factor 1-alpha 1 (EEF1A1).	[48]
Etretinate	DM2CZFA	Approved	Etretinate decreases the expression of Elongation factor 1-alpha 1 (EEF1A1).	[49]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene increases the expression of Elongation factor 1-alpha 1 (EEF1A1).	[50]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Elongation factor 1-alpha 1 (EEF1A1).	[51]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Elongation factor 1-alpha 1 (EEF1A1).	[52]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the expression of Elongation factor 1-alpha 1 (EEF1A1).	[53]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Elongation factor 1-alpha 1 (EEF1A1).	[54]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Elongation factor 1-alpha 1 (EEF1A1).	[55]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Elongation factor 1-alpha 1 (EEF1A1).	[56]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Elongation factor 1-alpha 1 (EEF1A1).	[57]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Dihydroartemisinin	DMBXVMZ	Approved	Dihydroartemisinin affects the binding of Elongation factor 1-alpha 1 (EEF1A1).	[47]

References

• [1] Semi-Quantitative Mass Spectrometry in AML Cells Identifies New Non-Genomic Targets of the EZH2 Methyltransferase.Int J Mol Sci. 2017 Jul 5;18(7):1440. doi: 10.3390/ijms18071440.
• [2] Dysregulation of Elongation Factor 1A Expression is Correlated with Synaptic Plasticity Impairments in Alzheimer's Disease.J Alzheimers Dis. 2016 Sep 6;54(2):669-78. doi: 10.3233/JAD-160036.
• [3] Contradictory mRNA and protein misexpression of EEF1A1 in ductal breast carcinoma due to cell cycle regulation and cellular stress.Sci Rep. 2018 Sep 17;8(1):13904. doi: 10.1038/s41598-018-32272-x.
• [4] Neuroprotection Mediated by Upregulation of Endothelial Nitric Oxide Synthase in Rho-Associated, Coiled-Coil-Containing Kinase 2 Deficient Mice.Circ J. 2018 Mar 23;82(4):1195-1204. doi: 10.1253/circj.CJ-17-0732. Epub 2018 Jan 19.
• [5] Identification of suitable reference genes for measurement of gene expression in human cervical tissues.Anal Biochem. 2010 Oct 15;405(2):224-9. doi: 10.1016/j.ab.2010.06.029. Epub 2010 Jun 19.
• [6] An axon regeneration signature in a Charcot-Marie-Tooth disease type 2 patient.J Neurogenet. 2009;23(3):324-8. doi: 10.1080/01677060802447585.
• [7] Expression of EEF1A1 Is Associated with Prognosis of Patients with Colon Adenocarcinoma.J Clin Med. 2019 Nov 7;8(11):1903. doi: 10.3390/jcm8111903.
• [8] Identification and Validation of a Potential Marker of Tissue Quality Using Gene Expression Analysis of Human Colorectal Tissue.PLoS One. 2015 Jul 29;10(7):e0133987. doi: 10.1371/journal.pone.0133987. eCollection 2015.
• [9] Characterization of a major colon cancer susceptibility locus (Ccs3) on mouse chromosome 3.Oncogene. 2010 Feb 4;29(5):647-61. doi: 10.1038/onc.2009.369. Epub 2009 Nov 16.
• [10] Two-dimensional differential in-gel electrophoresis for identification of gastric cancer-specific protein markers.Oncol Rep. 2009 Jun;21(6):1429-37. doi: 10.3892/or_00000371.
• [11] The human Y-encoded testis-specific protein interacts functionally with eukaryotic translation elongation factor eEF1A, a putative oncoprotein.Int J Cancer. 2008 Oct 1;123(7):1573-85. doi: 10.1002/ijc.23697.
• [12] Opposing roles of C/EBP and eEF1A1 in Sp1-regulated miR-122 transcription.RNA Biol. 2020 Feb;17(2):202-210. doi: 10.1080/15476286.2019.1673656. Epub 2019 Oct 7.
• [13] Proteomic analysis of rat cartilage: the identification of differentially expressed proteins in the early stages of osteoarthritis.Proteome Sci. 2014 Nov 18;12(1):55. doi: 10.1186/s12953-014-0055-0. eCollection 2014.
• [14] Resveratrol induces premature senescence in lung cancer cells via ROS-mediated DNA damage.PLoS One. 2013;8(3):e60065. doi: 10.1371/journal.pone.0060065. Epub 2013 Mar 22.
• [15] Borrelia burgdorferi elongation factor EF-Tu is an immunogenic protein during Lyme borreliosis.Emerg Microbes Infect. 2015 Sep 2;4(9):e54. doi: 10.1038/emi.2015.54.
• [16] Identification of the human prostatic carcinoma oncogene PTI-1 by rapid expression cloning and differential RNA display.Proc Natl Acad Sci U S A. 1995 Jul 18;92(15):6778-82. doi: 10.1073/pnas.92.15.6778.
• [17] Antisense inhibition of the PTI-1 oncogene reverses cancer phenotypes.Proc Natl Acad Sci U S A. 1998 Feb 17;95(4):1764-9. doi: 10.1073/pnas.95.4.1764.
• [18] Elongation Factor 1A-1 Is a Mediator of Hepatocyte Lipotoxicity Partly through Its Canonical Function in Protein Synthesis.PLoS One. 2015 Jun 23;10(6):e0131269. doi: 10.1371/journal.pone.0131269. eCollection 2015.
• [19] Identification of genes showing differential expression in antisense K-ras-transduced pancreatic cancer cells with suppressed tumorigenicity.Cancer Res. 1999 Nov 1;59(21):5565-71.
• [20] Immunization with pneumococcal elongation factor Tu enhances serotype-independent protection against Streptococcus pneumoniae infection.Vaccine. 2019 Jan 3;37(1):160-168. doi: 10.1016/j.vaccine.2018.11.015. Epub 2018 Nov 13.
• [21] Prostate-tumor-inducing gene-1 analysis in human prostate cancer cells and tissue in relation to Mycoplasma infection.Cancer Invest. 2008 Oct;26(8):800-8. doi: 10.1080/07357900701874633.
• [22] Dissecting the expression of EEF1A1/2 genes in human prostate cancer cells: the potential of EEF1A2 as a hallmark for prostate transformation and progression.Br J Cancer. 2012 Jan 3;106(1):166-73. doi: 10.1038/bjc.2011.500. Epub 2011 Nov 17.
• [23] Transient reduction of PTI-1 expression by short interfering RNAs inhibits the growth of human prostate cancer cell lines.Tohoku J Exp Med. 2006 Jun;209(2):141-8. doi: 10.1620/tjem.209.141.
• [24] Biophysical characterization and ligand-binding properties of the elongation factor Tu from Mycobacterium tuberculosis.Acta Biochim Biophys Sin (Shanghai). 2019 Feb 1;51(2):139-149. doi: 10.1093/abbs/gmy164.
• [25] High eukaryotic translation elongation factor 1 alpha 1 expression promotes proliferation and predicts poor prognosis in clear cell renal cell carcinoma.Neoplasma. 2020 Jan;67(1):78-84. doi: 10.4149/neo_2019_190224N158. Epub 2019 Nov 26.
• [26] Characterization of a putative ovarian oncogene, elongation factor 1alpha, isolated by panning a synthetic phage display single-chain variable fragment library with cultured human ovarian cancer cells.Clin Cancer Res. 2007 Oct 1;13(19):5889-96. doi: 10.1158/1078-0432.CCR-07-0703.
• [27] Independent overexpression of the subunits of translation elongation factor complex eEF1H in human lung cancer.BMC Cancer. 2014 Dec 3;14:913. doi: 10.1186/1471-2407-14-913.
• [28] The expression profile and prognostic significance of eukaryotic translation elongation factors in different cancers.PLoS One. 2018 Jan 17;13(1):e0191377. doi: 10.1371/journal.pone.0191377. eCollection 2018.
• [29] cDNA microarray profiling of rat mammary gland carcinomas induced by 2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine and 7,12-dimethylbenz[a]anthracene.Carcinogenesis. 2002 Oct;23(10):1561-8. doi: 10.1093/carcin/23.10.1561.
• [30] Early defects in translation elongation factor 1 levels at excitatory synapses in -synucleinopathy.Acta Neuropathol. 2019 Dec;138(6):971-986. doi: 10.1007/s00401-019-02063-3. Epub 2019 Aug 26.
• [31] Housekeeping gene validation for RT-qPCR studies on synovial fibroblasts derived from healthy and osteoarthritic patients with focus on mechanical loading.PLoS One. 2019 Dec 6;14(12):e0225790. doi: 10.1371/journal.pone.0225790. eCollection 2019.
• [32] Altered machinery of protein synthesis is region- and stage-dependent and is associated with -synuclein oligomers in Parkinson's disease.Acta Neuropathol Commun. 2015 Dec 1;3:76. doi: 10.1186/s40478-015-0257-4.
• [33] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [34] Proteomics investigations of drug-induced hepatotoxicity in HepG2 cells. Toxicol Sci. 2011 Mar;120(1):109-22.
• [35] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [36] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [37] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [38] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [39] Systems analysis of transcriptome and proteome in retinoic acid/arsenic trioxide-induced cell differentiation/apoptosis of promyelocytic leukemia. Proc Natl Acad Sci U S A. 2005 May 24;102(21):7653-8.
• [40] Comparison of the gene expression profiles of monocytic versus granulocytic lineages of HL-60 leukemia cell differentiation by DNA microarray analysis. Life Sci. 2003 Aug 15;73(13):1705-19. doi: 10.1016/s0024-3205(03)00515-0.
• [41] Gene microarray analysis of human renal cell carcinoma: the effects of HDAC inhibition and retinoid treatment. Cancer Biol Ther. 2008 Oct;7(10):1607-18.
• [42] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [43] Apoptosis, cell cycle progression and gene expression in TP53-depleted HCT116 colon cancer cells in response to short-term 5-fluorouracil treatment. Int J Oncol. 2007 Dec;31(6):1491-500.
• [44] DNA array analysis of the effects of aspirin on colon cancer cells: involvement of Rac1. Carcinogenesis. 2004 Jul;25(7):1293-8.
• [45] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [46] The effect of DNA methylation inhibitor 5-Aza-2'-deoxycytidine on human endometrial stromal cells. Hum Reprod. 2010 Nov;25(11):2859-69.
• [47] Untargeted Proteomics and Systems-Based Mechanistic Investigation of Artesunate in Human Bronchial Epithelial Cells. Chem Res Toxicol. 2015 Oct 19;28(10):1903-13. doi: 10.1021/acs.chemrestox.5b00105. Epub 2015 Sep 21.
• [48] Mitochondrial proteomics investigation of a cellular model of impaired dopamine homeostasis, an early step in Parkinson's disease pathogenesis. Mol Biosyst. 2014 Jun;10(6):1332-44.
• [49] Consequences of the natural retinoid/retinoid X receptor ligands action in human breast cancer MDA-MB-231 cell line: Focus on functional proteomics. Toxicol Lett. 2017 Nov 5;281:26-34. doi: 10.1016/j.toxlet.2017.09.001. Epub 2017 Sep 5.
• [50] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [51] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [52] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [53] Comparative proteomics reveals concordant and discordant biochemical effects of caffeine versus epigallocatechin-3-gallate in human endothelial cells. Toxicol Appl Pharmacol. 2019 Sep 1;378:114621. doi: 10.1016/j.taap.2019.114621. Epub 2019 Jun 10.
• [54] Bisphenol-A and estradiol exert novel gene regulation in human MCF-7 derived breast cancer cells. Mol Cell Endocrinol. 2004 Jun 30;221(1-2):47-55. doi: 10.1016/j.mce.2004.04.010.
• [55] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [56] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [57] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [58] Networking of differentially expressed genes in human cancer cells resistant to methotrexate. Genome Med. 2009 Sep 4;1(9):83. doi: 10.1186/gm83.
• [59] Plitidepsin has potent preclinical efficacy against SARS-CoV-2 by targeting the host protein eEF1A. Science. 2021 Feb 26;371(6532):926-931. doi: 10.1126/science.abf4058. Epub 2021 Jan 25.