Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0TL3Q5)

• DOT Name: Molybdenum cofactor sulfurase (MOCOS)
• Synonyms: MCS; MOS; MoCo sulfurase; hMCS; EC 2.8.1.9; Molybdenum cofactor sulfurtransferase
• Gene Name: MOCOS
• Related Disease:
  Non-insulin dependent diabetes
  Type-1/2 diabetes
  Xanthinuria type II
  Acute lymphocytic leukaemia
  Acute myocardial infarction
  Anemia
  Arteriosclerosis
  Atherosclerosis
  Autism spectrum disorder
  Cardiac failure
  Childhood acute lymphoblastic leukemia
  Congestive heart failure
  Cushing disease
  Depression
  Freeman-Sheldon syndrome
  Insomnia
  Major depressive disorder
  Mixed anxiety and depressive disorder
  Nephropathy
  Pancytopenia
  Psoriasis
  Restless legs syndrome
  Sleep disorder
  Thrombocytopenia
  Transposition of the great arteries
  Vasculitis
  Xanthinuria type I
  Anxiety
  Anxiety disorder
  Chronic obstructive pulmonary disease
  Stroke
  Subarachnoid hemorrhage
  Advanced cancer
  Arrhythmia
  Bone osteosarcoma
  Cardiomyopathy
  Metastatic malignant neoplasm
  Migraine disorder
  Non-alcoholic steatohepatitis
  Osteoarthritis
  Osteosarcoma
  Post-traumatic stress disorder
• UniProt ID: MOCOS_HUMAN
• EC Number: 2.8.1.9
• Pfam ID: PF00266 ; PF03473 ; PF03476
• Sequence:
  MAGAAAESGRELWTFAGSRDPSAPRLAYGYGPGSLRELRAREFSRLAGTVYLDHAGATLF
  SQSQLESFTSDLMENTYGNPHSQNISSKLTHDTVEQVRYRILAHFHTTAEDYTVIFTAGS
  TAALKLVAEAFPWVSQGPESSGSRFCYLTDSHTSVVGMRNVTMAINVISTPVRPEDLWSA
  EERSASASNPDCQLPHLFCYPAQSNFSGVRYPLSWIEEVKSGRLHPVSTPGKWFVLLDAA
  SYVSTSPLDLSAHQADFVPISFYKIFGFPTGLGALLVHNRAAPLLRKTYFGGGTASAYLA
  GEDFYIPRQSVAQRFEDGTISFLDVIALKHGFDTLERLTGGMENIKQHTFTLAQYTYVAL
  SSLQYPNGAPVVRIYSDSEFSSPEVQGPIINFNVLDDKGNIIGYSQVDKMASLYNIHLRT
  GCFCNTGACQRHLGISNEMVRKHFQAGHVCGDNMDLIDGQPTGSVRISFGYMSTLDDVQA
  FLRFIIDTRLHSSGDWPVPQAHADTGETGAPSADSQADVIPAVMGRRSLSPQEDALTGSR
  VWNNSSTVNAVPVAPPVCDVARTQPTPSEKAAGVLEGALGPHVVTNLYLYPIKSCAAFEV
  TRWPVGNQGLLYDRSWMVVNHNGVCLSQKQEPRLCLIQPFIDLRQRIMVIKAKGMEPIEV
  PLEENSERTQIRQSRVCADRVSTYDCGEKISSWLSTFFGRPCHLIKQSSNSQRNAKKKHG
  KDQLPGTMATLSLVNEAQYLLINTSSILELHRQLNTSDENGKEELFSLKDLSLRFRANII
  INGKRAFEEEKWDEISIGSLRFQVLGPCHRCQMICIDQQTGQRNQHVFQKLSESRETKVN
  FGMYLMHASLDLSSPCFLSVGSQVLPVLKENVEGHDLPASEKHQDVTS
• Function: Sulfurates the molybdenum cofactor. Sulfation of molybdenum is essential for xanthine dehydrogenase (XDH) and aldehyde oxidase (ADO) enzymes in which molybdenum cofactor is liganded by 1 oxygen and 1 sulfur atom in active form. In vitro, the C-terminal domain is able to reduce N-hydroxylated prodrugs, such as benzamidoxime.
• KEGG Pathway:
  Folate biosynthesis (hsa00790)
  Metabolic pathways (hsa01100)
• Reactome Pathway: Molybdenum cofactor biosynthesis (R-HSA-947581)

Molecular Interaction Atlas (MIA) of This DOT

42 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Non-insulin dependent diabetes	DISK1O5Z	Definitive	Genetic Variation	[1]
Type-1/2 diabetes	DISIUHAP	Definitive	Biomarker	[1]
Xanthinuria type II	DISRWX6S	Definitive	Autosomal recessive	[2]
Acute lymphocytic leukaemia	DISPX75S	Strong	Biomarker	[3]
Acute myocardial infarction	DISE3HTG	Strong	Biomarker	[4]
Anemia	DISTVL0C	Strong	Biomarker	[5]
Arteriosclerosis	DISK5QGC	Strong	Genetic Variation	[6]
Atherosclerosis	DISMN9J3	Strong	Genetic Variation	[6]
Autism spectrum disorder	DISXK8NV	Strong	Biomarker	[7]
Cardiac failure	DISDC067	Strong	Biomarker	[8]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Strong	Biomarker	[3]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[8]
Cushing disease	DISOG6P2	Strong	Altered Expression	[9]
Depression	DIS3XJ69	Strong	Biomarker	[10]
Freeman-Sheldon syndrome	DIS7V9PS	Strong	Biomarker	[11]
Insomnia	DIS0AFR7	Strong	Biomarker	[12]
Major depressive disorder	DIS4CL3X	Strong	Genetic Variation	[13]
Mixed anxiety and depressive disorder	DISV809X	Strong	Genetic Variation	[14]
Nephropathy	DISXWP4P	Strong	Biomarker	[15]
Pancytopenia	DISVKEHV	Strong	Biomarker	[16]
Psoriasis	DIS59VMN	Strong	Genetic Variation	[17]
Restless legs syndrome	DISNWY00	Strong	Biomarker	[18]
Sleep disorder	DIS3JP1U	Strong	Biomarker	[19]
Thrombocytopenia	DISU61YW	Strong	Biomarker	[5]
Transposition of the great arteries	DISPXJ8X	Strong	Genetic Variation	[20]
Vasculitis	DISQRKDX	Strong	Biomarker	[16]
Xanthinuria type I	DISIRVYD	Strong	Genetic Variation	[20]
Anxiety	DISIJDBA	moderate	Genetic Variation	[21]
Anxiety disorder	DISBI2BT	moderate	Genetic Variation	[21]
Chronic obstructive pulmonary disease	DISQCIRF	moderate	Biomarker	[22]
Stroke	DISX6UHX	moderate	Biomarker	[23]
Subarachnoid hemorrhage	DISI7I8Y	Disputed	Altered Expression	[24]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[10]
Arrhythmia	DISFF2NI	Limited	Genetic Variation	[25]
Bone osteosarcoma	DIST1004	Limited	Biomarker	[26]
Cardiomyopathy	DISUPZRG	Limited	Biomarker	[27]
Metastatic malignant neoplasm	DIS86UK6	Limited	Biomarker	[26]
Migraine disorder	DISFCQTG	Limited	Biomarker	[28]
Non-alcoholic steatohepatitis	DIST4788	Limited	Genetic Variation	[29]
Osteoarthritis	DIS05URM	Limited	Genetic Variation	[30]
Osteosarcoma	DISLQ7E2	Limited	Biomarker	[26]
Post-traumatic stress disorder	DISHL1EY	Limited	Genetic Variation	[31]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Etoposide	DMNH3PG	Approved	Molybdenum cofactor sulfurase (MOCOS) affects the response to substance of Etoposide.	[51]
Mitoxantrone	DMM39BF	Approved	Molybdenum cofactor sulfurase (MOCOS) affects the response to substance of Mitoxantrone.	[51]

This DOT Affected the Biotransformations of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Mercaptopurine	DMTM2IK	Approved	Molybdenum cofactor sulfurase (MOCOS) decreases the oxidation of Mercaptopurine.	[16]

18 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Molybdenum cofactor sulfurase (MOCOS).	[32]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Molybdenum cofactor sulfurase (MOCOS).	[33]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Molybdenum cofactor sulfurase (MOCOS).	[34]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Molybdenum cofactor sulfurase (MOCOS).	[35]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Molybdenum cofactor sulfurase (MOCOS).	[36]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Molybdenum cofactor sulfurase (MOCOS).	[37]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Molybdenum cofactor sulfurase (MOCOS).	[38]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Molybdenum cofactor sulfurase (MOCOS).	[39]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Molybdenum cofactor sulfurase (MOCOS).	[40]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Molybdenum cofactor sulfurase (MOCOS).	[41]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Molybdenum cofactor sulfurase (MOCOS).	[42]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of Molybdenum cofactor sulfurase (MOCOS).	[43]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Molybdenum cofactor sulfurase (MOCOS).	[44]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Molybdenum cofactor sulfurase (MOCOS).	[45]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Molybdenum cofactor sulfurase (MOCOS).	[46]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Molybdenum cofactor sulfurase (MOCOS).	[47]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Molybdenum cofactor sulfurase (MOCOS).	[49]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Molybdenum cofactor sulfurase (MOCOS).	[50]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of Molybdenum cofactor sulfurase (MOCOS).	[48]

References

• [1] As Time Goes by: Anxiety Negatively Affects the Perceived Quality of Life in Patients With Type 2 Diabetes of Long Duration.Front Psychol. 2019 Jul 31;10:1779. doi: 10.3389/fpsyg.2019.01779. eCollection 2019.
• [2] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [3] Adult acute lymphoblastic leukemia phenotypes defined by monoclonal antibodies.Blood. 1985 Mar;65(3):730-5.
• [4] The role of different mechanical circulatory support devices and their timing of implantation on myocardial damage and mid-term recovery in acute myocardial infarction related cardiogenic shock.J Interv Cardiol. 2018 Dec;31(6):717-724. doi: 10.1111/joic.12569. Epub 2018 Nov 20.
• [5] Clinical and equipment-related factors associated with the adequate peripheral blood stem cell collection in autologous transplant at a tertiary cancer center in Kerala - A retrospective cohort study.Transfus Apher Sci. 2019 Aug;58(4):457-463. doi: 10.1016/j.transci.2019.05.007. Epub 2019 Jun 21.
• [6] Suppression of proatherogenic leukocyte interactions by MCS-18--Impact on advanced atherosclerosis in ApoE-deficient mice.Atherosclerosis. 2016 Feb;245:101-10. doi: 10.1016/j.atherosclerosis.2015.12.001. Epub 2015 Dec 15.
• [7] Olfactory stem cells reveal MOCOS as a new player in autism spectrum disorders.Mol Psychiatry. 2016 Sep;21(9):1215-24. doi: 10.1038/mp.2015.106. Epub 2015 Aug 4.
• [8] Third Annual Report From the ISHLT Mechanically Assisted Circulatory Support Registry: A comparison of centrifugal and axial continuous-flow left ventricular assist devices.J Heart Lung Transplant. 2019 Apr;38(4):352-363. doi: 10.1016/j.healun.2019.02.004.
• [9] Quality of life is significantly impaired in both secretory and non-functioning pituitary adenomas.Clin Endocrinol (Oxf). 2019 Mar;90(3):457-467. doi: 10.1111/cen.13915. Epub 2019 Jan 15.
• [10] Infertility and Health-Related Quality of Life in United States Women Veterans.J Womens Health (Larchmt). 2020 Mar;29(3):412-419. doi: 10.1089/jwh.2019.7798. Epub 2019 Nov 22.
• [11] Home-Based Exercise Enhances Health-Related Quality of Life in Persons With Spinal Cord Injury: ARandomized Controlled Trial.Arch Phys Med Rehabil. 2018 Oct;99(10):1998-2006.e1. doi: 10.1016/j.apmr.2018.05.008. Epub 2018 Jun 11.
• [12] Relationship between Sleep Disorders and Health Related Quality of Life-Results from the Georgia SOMNUS Study.Int J Environ Res Public Health. 2018 Jul 26;15(8):1588. doi: 10.3390/ijerph15081588.
• [13] Impact of pre-diagnosis depressive symptoms and health-related quality of life on treatment choice for ductal carcinoma in situ and stage I breast cancer in older women.Breast Cancer Res Treat. 2019 Feb;173(3):709-717. doi: 10.1007/s10549-018-5006-5. Epub 2018 Nov 8.
• [14] The influence of selected psychological variables on quality of life of chronically dialysed patients.Scand J Caring Sci. 2019 Dec;33(4):840-847. doi: 10.1111/scs.12680. Epub 2019 May 9.
• [15] The prevalence of depression and the association between depression and kidney function and health-related quality of life in elderly patients with chronic kidney disease: a multicenter cross-sectional study.Clin Interv Aging. 2019 May 15;14:905-913. doi: 10.2147/CIA.S203186. eCollection 2019.
• [16] Thiopurine-induced toxicity is associated with dysfunction variant of the human molybdenum cofactor sulfurase gene (xanthinuria type II). Toxicol Appl Pharmacol. 2018 Aug 15;353:102-108. doi: 10.1016/j.taap.2018.06.015. Epub 2018 Jun 20.
• [17] Burden of chronic urticaria relative to psoriasis in five European countries.J Eur Acad Dermatol Venereol. 2018 Feb;32(2):282-290. doi: 10.1111/jdv.14584. Epub 2017 Oct 12.
• [18] Restless legs syndrome is associated with major comorbidities in a population of Danish blood donors.Sleep Med. 2018 May;45:124-131. doi: 10.1016/j.sleep.2018.02.007. Epub 2018 Mar 8.
• [19] Yoga Program for High-Grade Glioma Patients Undergoing Radiotherapy and Their Family Caregivers.Integr Cancer Ther. 2018 Jun;17(2):332-336. doi: 10.1177/1534735417689882. Epub 2017 Feb 2.
• [20] Mutation of human molybdenum cofactor sulfurase gene is responsible for classical xanthinuria type II. Biochem Biophys Res Commun. 2001 Apr 20;282(5):1194-200. doi: 10.1006/bbrc.2001.4719.
• [21] Relationships between coping, anxiety, depression and health-related quality of life in outpatients with substance use disorders: results of the SUBUSQOL study.Psychol Health Med. 2020 Feb;25(2):179-189. doi: 10.1080/13548506.2019.1679847. Epub 2019 Oct 17.
• [22] Pulmonary Rehabilitation Outcomes after Single or Double Lung Transplantation in Patients with Chronic Obstructive Pulmonary Disease or Interstitial Lung Disease.Respiration. 2017;94(2):178-185. doi: 10.1159/000477351. Epub 2017 Jun 10.
• [23] Intraarterial route increases the risk of cerebral lesions after mesenchymal cell administration in animal model of ischemia.Sci Rep. 2017 Jan 16;7:40758. doi: 10.1038/srep40758.
• [24] Excessive release of endogenous neuropeptide Y into cerebrospinal fluid after treatment of spontaneous subarachnoid haemorrhage and its possible impact on self-reported neuropsychological performance - results of a prospective clinical pilot study on good-grade patients.Neurol Res. 2018 Dec;40(12):1001-1013. doi: 10.1080/01616412.2018.1508547. Epub 2018 Sep 14.
• [25] ECMO and Short-term Support for Cardiogenic Shock in Heart Failure.Curr Cardiol Rep. 2018 Aug 16;20(10):87. doi: 10.1007/s11886-018-1041-4.
• [26] Novel Triazole-Piperazine Hybrid Molecules Induce Apoptosis via Activation of the Mitochondrial Pathway and Exhibit Antitumor Efficacy in Osteosarcoma Xenograft Nude Mice Model.ACS Chem Biol. 2017 Mar 17;12(3):753-768. doi: 10.1021/acschembio.6b01007. Epub 2017 Jan 26.
• [27] Polymerase chain reaction amplification of three different Trypanosoma cruzi DNA sequences from human chagasic cardiac tissue.Am J Trop Med Hyg. 1998 Oct;59(4):563-70. doi: 10.4269/ajtmh.1998.59.563.
• [28] Patients' perspective on the burden of migraine in Europe: a cross-sectional analysis of survey data in France, Germany, Italy, Spain, and the United Kingdom.J Headache Pain. 2018 Sep 10;19(1):82. doi: 10.1186/s10194-018-0907-6.
• [29] Metformin ameliorates activation of hepatic stellate cells and hepatic fibrosis by succinate and GPR91 inhibition.Biochem Biophys Res Commun. 2018 Jan 22;495(4):2649-2656. doi: 10.1016/j.bbrc.2017.12.143. Epub 2017 Dec 24.
• [30] Influence of reduction quality on functional outcome and quality of life in treatment of tibial plafond fractures: a retrospective cohort study.BMC Musculoskelet Disord. 2019 Nov 13;20(1):534. doi: 10.1186/s12891-019-2932-2.
• [31] An Assessment of Long-Term Physical and Emotional Quality of Life of Persons Injured on 9/11/2001.Int J Environ Res Public Health. 2019 Mar 23;16(6):1054. doi: 10.3390/ijerph16061054.
• [32] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [33] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [34] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [35] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [36] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [37] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [38] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [39] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [40] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [41] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [42] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [43] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [44] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [45] Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
• [46] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [47] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [48] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [49] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [50] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [51] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.
• [52] Thiopurine-induced toxicity is associated with dysfunction variant of the human molybdenum cofactor sulfurase gene (xanthinuria type II). Toxicol Appl Pharmacol. 2018 Aug 15;353:102-108. doi: 10.1016/j.taap.2018.06.015. Epub 2018 Jun 20.