Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2UGZA9)

• DOT Name: CD63 antigen (CD63)
• Synonyms: Granulophysin; Lysosomal-associated membrane protein 3; LAMP-3; Lysosome integral membrane protein 1; Limp1; Melanoma-associated antigen ME491; OMA81H; Ocular melanoma-associated antigen; Tetraspanin-30; Tspan-30; CD antigen CD63
• Gene Name: CD63
• Related Disease:
  Melanoma
  Acute myelogenous leukaemia
  Advanced cancer
  Alzheimer disease
  Astrocytoma
  Bone osteosarcoma
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Carcinoma of esophagus
  Colon cancer
  Colon carcinoma
  Esophageal cancer
  Esophageal squamous cell carcinoma
  Essential thrombocythemia
  Glioblastoma multiforme
  Hantavirus infection
  Hepatitis C virus infection
  Hermansky-Pudlak syndrome
  Liver cirrhosis
  Matthew-Wood syndrome
  Metastatic malignant neoplasm
  Nasopharyngeal carcinoma
  Neoplasm of esophagus
  Non-small-cell lung cancer
  Osteosarcoma
  Ovarian neoplasm
  Polycythemia vera
  Systemic lupus erythematosus
  Thyroid gland carcinoma
  Thyroid gland papillary carcinoma
  Thyroid tumor
  Urticaria
  Venous thromboembolism
  Carcinoma
  Colorectal carcinoma
  Type-1 diabetes
  Adenocarcinoma
  Adult glioblastoma
  Asthma
  Chronic obstructive pulmonary disease
  Gastric cancer
  Neoplasm
  Prostate cancer
  Prostate carcinoma
  Rheumatoid arthritis
  Stomach cancer
• UniProt ID: CD63_HUMAN
• Pfam ID: PF00335
• Sequence:
  MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAV
  GVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFR
  QQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGIN
  FNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
• Function: Functions as a cell surface receptor for TIMP1 and plays a role in the activation of cellular signaling cascades. Plays a role in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2 and MAP kinases. Promotes cell survival, reorganization of the actin cytoskeleton, cell adhesion, spreading and migration, via its role in the activation of AKT and FAK/PTK2. Plays a role in VEGFA signaling via its role in regulating the internalization of KDR/VEGFR2. Plays a role in intracellular vesicular transport processes, and is required for normal trafficking of the PMEL luminal domain that is essential for the development and maturation of melanocytes. Plays a role in the adhesion of leukocytes onto endothelial cells via its role in the regulation of SELP trafficking. May play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, but not in mast cell degranulation in response to other stimuli.
• Tissue Specificity: Detected in platelets (at protein level). Dysplastic nevi, radial growth phase primary melanomas, hematopoietic cells, tissue macrophages.
• KEGG Pathway:
  Lysosome (hsa04142)
  Proteoglycans in cancer (hsa05205)
• Reactome Pathway:
  Neutrophil degranulation (R-HSA-6798695)
  Platelet degranulation (R-HSA-114608)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Melanoma	DIS1RRCY	Definitive	Biomarker	[1]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Alzheimer disease	DISF8S70	Strong	Biomarker	[4]
Astrocytoma	DISL3V18	Strong	Biomarker	[5]
Bone osteosarcoma	DIST1004	Strong	Altered Expression	[6]
Breast cancer	DIS7DPX1	Strong	Biomarker	[7]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[7]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[8]
Carcinoma of esophagus	DISS6G4D	Strong	Altered Expression	[9]
Colon cancer	DISVC52G	Strong	Altered Expression	[10]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[10]
Esophageal cancer	DISGB2VN	Strong	Altered Expression	[9]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[11]
Essential thrombocythemia	DISWWK11	Strong	Altered Expression	[12]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[5]
Hantavirus infection	DISZFTMH	Strong	Biomarker	[13]
Hepatitis C virus infection	DISQ0M8R	Strong	Biomarker	[14]
Hermansky-Pudlak syndrome	DISCY0HQ	Strong	Biomarker	[15]
Liver cirrhosis	DIS4G1GX	Strong	Biomarker	[16]
Matthew-Wood syndrome	DISA7HR7	Strong	Biomarker	[17]
Metastatic malignant neoplasm	DIS86UK6	Strong	Altered Expression	[18]
Nasopharyngeal carcinoma	DISAOTQ0	Strong	Biomarker	[19]
Neoplasm of esophagus	DISOLKAQ	Strong	Altered Expression	[9]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[20]
Osteosarcoma	DISLQ7E2	Strong	Altered Expression	[6]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[21]
Polycythemia vera	DISB5FPO	Strong	Biomarker	[22]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[23]
Thyroid gland carcinoma	DISMNGZ0	Strong	Altered Expression	[18]
Thyroid gland papillary carcinoma	DIS48YMM	Strong	Genetic Variation	[24]
Thyroid tumor	DISLVKMD	Strong	Biomarker	[18]
Urticaria	DIS9WQAI	Strong	Biomarker	[25]
Venous thromboembolism	DISUR7CR	Strong	Biomarker	[26]
Carcinoma	DISH9F1N	moderate	Altered Expression	[27]
Colorectal carcinoma	DIS5PYL0	moderate	Biomarker	[28]
Type-1 diabetes	DIS7HLUB	moderate	Biomarker	[29]
Adenocarcinoma	DIS3IHTY	Limited	Biomarker	[30]
Adult glioblastoma	DISVP4LU	Limited	Biomarker	[5]
Asthma	DISW9QNS	Limited	Biomarker	[31]
Chronic obstructive pulmonary disease	DISQCIRF	Limited	Altered Expression	[32]
Gastric cancer	DISXGOUK	Limited	Biomarker	[33]
Neoplasm	DISZKGEW	Limited	Biomarker	[11]
Prostate cancer	DISF190Y	Limited	Biomarker	[34]
Prostate carcinoma	DISMJPLE	Limited	Biomarker	[34]
Rheumatoid arthritis	DISTSB4J	Limited	Biomarker	[35]
Stomach cancer	DISKIJSX	Limited	Biomarker	[33]

21 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of CD63 antigen (CD63).	[36]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of CD63 antigen (CD63).	[37]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of CD63 antigen (CD63).	[38]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of CD63 antigen (CD63).	[39]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of CD63 antigen (CD63).	[40]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of CD63 antigen (CD63).	[41]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of CD63 antigen (CD63).	[42]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of CD63 antigen (CD63).	[43]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of CD63 antigen (CD63).	[44]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of CD63 antigen (CD63).	[45]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of CD63 antigen (CD63).	[46]
Clozapine	DMFC71L	Approved	Clozapine increases the expression of CD63 antigen (CD63).	[47]
Diphenylpyraline	DMW4X37	Approved	Diphenylpyraline increases the expression of CD63 antigen (CD63).	[46]
Asasantin	DMCZIHT	Approved	Asasantin decreases the expression of CD63 antigen (CD63).	[48]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of CD63 antigen (CD63).	[49]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of CD63 antigen (CD63).	[52]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of CD63 antigen (CD63).	[53]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of CD63 antigen (CD63).	[54]
Glyphosate	DM0AFY7	Investigative	Glyphosate decreases the expression of CD63 antigen (CD63).	[55]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine decreases the expression of CD63 antigen (CD63).	[56]
Fmet-leu-phe	DMQ391A	Investigative	Fmet-leu-phe increases the expression of CD63 antigen (CD63).	[57]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of CD63 antigen (CD63).	[50]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of CD63 antigen (CD63).	[51]

References

• [1] CD63 tetraspanin is a negative driver of epithelial-to-mesenchymal transition in human melanoma cells.J Invest Dermatol. 2014 Dec;134(12):2947-2956. doi: 10.1038/jid.2014.258. Epub 2014 Jun 18.
• [2] Leukemia-derived exosomes induced IL-8 production in bone marrow stromal cells to protect the leukemia cells against chemotherapy.Life Sci. 2019 Mar 15;221:187-195. doi: 10.1016/j.lfs.2019.02.003. Epub 2019 Feb 2.
• [3] Isolation and Profiling of Circulating Tumor-Associated Exosomes Using Extracellular Vesicular Lipid-Protein Binding Affinity Based Microfluidic Device.Small. 2019 Nov;15(47):e1903600. doi: 10.1002/smll.201903600. Epub 2019 Oct 7.
• [4] Subtyping of circulating exosome-bound amyloid reflects brain plaque deposition.Nat Commun. 2019 Mar 8;10(1):1144. doi: 10.1038/s41467-019-09030-2.
• [5] Co-expression of TIMP-1 and its cell surface binding partner CD63 in glioblastomas.BMC Cancer. 2018 Mar 9;18(1):270. doi: 10.1186/s12885-018-4179-y.
• [6] Ameloblastin induces tumor suppressive phenotype and enhances chemosensitivity to doxorubicin via Src-Stat3 inactivation in osteosarcoma.Sci Rep. 2017 Jan 5;7:40187. doi: 10.1038/srep40187.
• [7] Novel breast cancer screening: combined expression of miR-21 and MMP-1 in urinary exosomes detects 95% of breast cancer without metastasis.Sci Rep. 2019 Sep 19;9(1):13595. doi: 10.1038/s41598-019-50084-5.
• [8] Expression of tetraspanin adaptor proteins below defined threshold values is associated with in vitro invasiveness of mammary carcinoma cells.Oncol Rep. 2003 Mar-Apr;10(2):405-10.
• [9] Decreased expression of CD63 tetraspanin protein predicts elevated malignant potential in human esophageal cancer.Oncol Lett. 2017 Jun;13(6):4245-4251. doi: 10.3892/ol.2017.6023. Epub 2017 Apr 11.
• [10] Disruption of Core 1-mediated O-glycosylation oppositely regulates CD44 expression in human colon cancer cells and tumor-derived exosomes.Biochem Biophys Res Commun. 2020 Jan 8;521(2):514-520. doi: 10.1016/j.bbrc.2019.10.149. Epub 2019 Oct 31.
• [11] Impact of tumor-infiltrating LAMP-3 dendritic cells on the prognosis of esophageal squamous cell carcinoma.Esophagus. 2019 Oct;16(4):333-344. doi: 10.1007/s10388-019-00669-w. Epub 2019 Apr 9.
• [12] JAK2V617F allele burden is associated with thrombotic mechanisms activation in polycythemia vera and essential thrombocythemia patients.Int J Hematol. 2014 Jan;99(1):32-40. doi: 10.1007/s12185-013-1475-9. Epub 2013 Nov 26.
• [13] Novel mutation in two brothers with Hermansky Pudlak syndrome type 3.Blood Cells Mol Dis. 2017 Sep;67:75-80. doi: 10.1016/j.bcmd.2017.03.001. Epub 2017 Mar 6.
• [14] Discovery of cellular proteins required for the early steps of HCV infection using integrative genomics.PLoS One. 2013 Apr 12;8(4):e60333. doi: 10.1371/journal.pone.0060333. Print 2013.
• [15] Defective AP-3-dependent VAMP8 trafficking impairs Weibel-Palade body exocytosis in Hermansky-Pudlak Syndrome type 2 blood outgrowth endothelial cells.Haematologica. 2019 Oct;104(10):2091-2099. doi: 10.3324/haematol.2018.207787. Epub 2019 Jan 10.
• [16] Dysfunctional neutrophil effector organelle mobilization and microbicidal protein release in alcohol-related cirrhosis.Am J Physiol Gastrointest Liver Physiol. 2017 Sep 1;313(3):G203-G211. doi: 10.1152/ajpgi.00112.2016. Epub 2017 Jun 22.
• [17] Integrated Analysis of Exosomal Protein Biomarkers on Alternating Current Electrokinetic Chips Enables Rapid Detection of Pancreatic Cancer in Patient Blood.ACS Nano. 2018 Apr 24;12(4):3311-3320. doi: 10.1021/acsnano.7b08199. Epub 2018 Mar 28.
• [18] CD82, and CD63 in thyroid cancer.Int J Mol Med. 2004 Oct;14(4):517-27.
• [19] Transmembrane Domains Mediate Intra- and Extracellular Trafficking of Epstein-Barr Virus Latent Membrane Protein 1.J Virol. 2018 Aug 16;92(17):e00280-18. doi: 10.1128/JVI.00280-18. Print 2018 Sep 1.
• [20] Label-Free Surface Protein Profiling of Extracellular Vesicles by an Electrokinetic Sensor.ACS Sens. 2019 May 24;4(5):1399-1408. doi: 10.1021/acssensors.9b00418. Epub 2019 May 7.
• [21] Expression and significance of the protein and mRNA of metastasis suppressor gene ME491/CD63 and integrin alpha5 in ovarian cancer tissues.Eur J Gynaecol Oncol. 2007;28(3):179-83.
• [22] Phosphoproteomic Landscaping Identifies Non-canonical cKIT Signaling in Polycythemia Vera Erythroid Progenitors.Front Oncol. 2019 Nov 22;9:1245. doi: 10.3389/fonc.2019.01245. eCollection 2019.
• [23] Contribution and underlying mechanisms of CXCR4 overexpression in patients with systemic lupus erythematosus.Cell Mol Immunol. 2017 Oct;14(10):842-849. doi: 10.1038/cmi.2016.47. Epub 2016 Sep 26.
• [24] BRAFV600E mutation, TIMP-1 upregulation, and NF-B activation: closing the loop on the papillary thyroid cancer trilogy.Endocr Relat Cancer. 2011 Nov 14;18(6):669-85. doi: 10.1530/ERC-11-0076. Print 2011 Dec.
• [25] Basophil CD63 expression in chronic spontaneous urticaria: correlation with allergic sensitization, serum autoreactivity and basophil reactivity.J Eur Acad Dermatol Venereol. 2017 Mar;31(3):463-468. doi: 10.1111/jdv.13912. Epub 2016 Sep 5.
• [26] Prevention of venous thromboembolism after resection of primary liver cancer with low molecular weight heparin and its association with P-selectin, lysosomal granule glycoprotein, platelet activating factor and plasma D-dimer.Eur Rev Med Pharmacol Sci. 2018 Jul;22(14):4657-4662. doi: 10.26355/eurrev_201807_15525.
• [27] Down-regulation of TM4SF is associated with the metastatic potential of gastric carcinoma TM4SF members in gastric carcinoma.World J Surg Oncol. 2011 Apr 27;9:43. doi: 10.1186/1477-7819-9-43.
• [28] DNase I enzyme-aided fluorescence signal amplification based on graphene oxide-DNA aptamer interactions for colorectal cancer exosome detection.Talanta. 2018 Jul 1;184:219-226. doi: 10.1016/j.talanta.2018.02.083. Epub 2018 Mar 29.
• [29] Activated platelets in subjects at increased risk of IDDM. DENIS Study Group. Deutsche Nikotinamid Interventionsstudie.Diabetologia. 1997 May;40(5):573-7. doi: 10.1007/s001250050717.
• [30] CD63 as a biomarker for predicting the clinical outcomes in adenocarcinoma of lung.Lung Cancer. 2007 Jul;57(1):46-53. doi: 10.1016/j.lungcan.2007.01.032. Epub 2007 Mar 12.
• [31] Cultured mast cells from patients with asthma and controls respond with similar sensitivity to recombinant Der p2-induced, IgE-mediated activation.Scand J Immunol. 2013 Oct;78(4):352-6. doi: 10.1111/sji.12085.
• [32] PMN degranulation in relation to CD63 expression and genetic polymorphisms in healthy individuals and COPD patients.Int J Mol Med. 2007 May;19(5):817-22. doi: 10.3892/ijmm.19.5.817.
• [33] Clinico-pathological significance of exosome marker CD63 expression on cancer cells and stromal cells in gastric cancer.PLoS One. 2018 Sep 17;13(9):e0202956. doi: 10.1371/journal.pone.0202956. eCollection 2018.
• [34] Nanoscale flow cytometry to distinguish subpopulations of prostate extracellular vesicles in patient plasma.Prostate. 2019 May;79(6):592-603. doi: 10.1002/pros.23764. Epub 2019 Jan 24.
• [35] The significance of platelet activation in rheumatoid arthritis.Clin Rheumatol. 2007 May;26(5):768-71. doi: 10.1007/s10067-007-0550-0. Epub 2007 Feb 6.
• [36] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [37] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [38] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [39] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [40] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [41] Metastatic potential of melanoma cells is not affected by electrochemotherapy. Melanoma Res. 2011 Jun;21(3):196-205. doi: 10.1097/CMR.0b013e328337abd7.
• [42] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [43] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [44] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [45] Fluorouracil induces apoptosis and surface molecule modulation of peripheral blood leukocytes. Clin Lab Haematol. 2004 Oct;26(5):327-33. doi: 10.1111/j.1365-2257.2004.00629.x.
• [46] The effects of dasatinib on IgE receptor-dependent activation and histamine release in human basophils. Blood. 2008 Mar 15;111(6):3097-107.
• [47] Toxicoproteomics reveals an effect of clozapine on autophagy in human liver spheroids. Toxicol Mech Methods. 2023 Jun;33(5):401-410. doi: 10.1080/15376516.2022.2156005. Epub 2022 Dec 19.
• [48] Magnitude and time course of platelet inhibition with Aggrenox and Aspirin in patients after ischemic stroke: the AGgrenox versus Aspirin Therapy Evaluation (AGATE) trial. Eur J Pharmacol. 2004 Sep 24;499(3):315-24. doi: 10.1016/j.ejphar.2004.07.114.
• [49] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [50] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [51] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [52] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [53] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [54] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [55] Alteration of estrogen-regulated gene expression in human cells induced by the agricultural and horticultural herbicide glyphosate. Hum Exp Toxicol. 2007 Sep;26(9):747-52. doi: 10.1177/0960327107083453.
• [56] Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
• [57] Stimulus-specific regulation of CD63 and CD203c membrane expression in human basophils by the flavonoid quercetin. Int Immunopharmacol. 2010 Feb;10(2):183-92. doi: 10.1016/j.intimp.2009.10.014. Epub 2009 Nov 1.