Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBQ48RF)

• DOT Name: FSD1-like protein (FSD1L)
• Synonyms: Coiled-coil domain-containing protein 10; FSD1 N-terminal-like protein
• Gene Name: FSD1L
• Related Disease:
  Atrial fibrillation
  Acute myocardial infarction
  Advanced cancer
  Arrhythmia
  Bladder cancer
  Bone osteosarcoma
  Breast cancer
  Breast carcinoma
  Carcinoma of liver and intrahepatic biliary tract
  Clear cell renal carcinoma
  Colorectal carcinoma
  Colorectal neoplasm
  Cystic fibrosis
  Dilated cardiomyopathy 1A
  Duchenne muscular dystrophy
  Epithelial ovarian cancer
  Esophageal squamous cell carcinoma
  Head-neck squamous cell carcinoma
  Hepatocellular carcinoma
  High blood pressure
  Liver cancer
  Lung cancer
  Lung carcinoma
  Metastatic malignant neoplasm
  Myocardial infarction
  Nasopharyngeal carcinoma
  Non-insulin dependent diabetes
  Non-small-cell lung cancer
  Osteosarcoma
  Ovarian cancer
  Ovarian neoplasm
  Squamous cell carcinoma
  Thyroid gland carcinoma
  Urinary bladder cancer
  Urinary bladder neoplasm
  Gastric cancer
  Stomach cancer
  Cardiac disease
  Asthma
  Cardiac failure
  Cardiovascular disease
  Congestive heart failure
  Coronary heart disease
  Glioblastoma multiforme
  Renal cell carcinoma
• UniProt ID: FSD1L_HUMAN
• Pfam ID: PF00622
• Sequence:
  MDSQKYCFKENENVTVDKACFLISNITIGPESINLQQEALQRIISTLANKNDEIQNFIDT
  LHHTLKGVQENSSNILSELDEEFDSLYSILDEVKESMINCIKQEQARKSQELQSQISQCN
  NALENSEELLEFATRSLDIKEPEEFSKAARQIKDRVTMASAFRLSLKPKVSDNMTHLMVD
  FSQERQMLQTLKFLPVPKAPEIDPVECLVADNSVTVAWRMPEEDNKIDHFILEHRKTNFD
  GLPRVKDERCWEIIDNIKGTEYTLSGLKFDSKYMNFRVRACNKAVAGEYSDPVTLETKAL
  NFNLDNSSSHLNLKVEDTCVEWDPTGGKGQESKIKGKENKGRSGTPSPKRTSVGSRPPAV
  RGSRDRFTGESYTVLGDTAIESGQHYWEVKAQKDCKSYSVGVAYKTLGKFDQLGKTNTSW
  CIHVNNWLQNTFAAKHNNKVKALDVTVPEKIGVFCDFDGGQLSFYDANSKQLLYSFKTKF
  TQPVLPGFMVWCGGLSLSTGMQVPSAVRTLQKSENGMTGSASSLNNVVTQ

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Atrial fibrillation	DIS15W6U	Definitive	Altered Expression	[1]
Acute myocardial infarction	DISE3HTG	Strong	Altered Expression	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Arrhythmia	DISFF2NI	Strong	Altered Expression	[4]
Bladder cancer	DISUHNM0	Strong	Altered Expression	[5]
Bone osteosarcoma	DIST1004	Strong	Altered Expression	[6]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[7]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[7]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Strong	Biomarker	[3]
Clear cell renal carcinoma	DISBXRFJ	Strong	Altered Expression	[8]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[3]
Colorectal neoplasm	DISR1UCN	Strong	Biomarker	[9]
Cystic fibrosis	DIS2OK1Q	Strong	Altered Expression	[10]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Biomarker	[11]
Duchenne muscular dystrophy	DISRQ3NV	Strong	Biomarker	[12]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[13]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[14]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[15]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[3]
High blood pressure	DISY2OHH	Strong	Biomarker	[16]
Liver cancer	DISDE4BI	Strong	Biomarker	[3]
Lung cancer	DISCM4YA	Strong	Biomarker	[17]
Lung carcinoma	DISTR26C	Strong	Biomarker	[17]
Metastatic malignant neoplasm	DIS86UK6	Strong	Altered Expression	[18]
Myocardial infarction	DIS655KI	Strong	Biomarker	[19]
Nasopharyngeal carcinoma	DISAOTQ0	Strong	Biomarker	[20]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[21]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[22]
Osteosarcoma	DISLQ7E2	Strong	Altered Expression	[6]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[13]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[13]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[23]
Thyroid gland carcinoma	DISMNGZ0	Strong	Biomarker	[24]
Urinary bladder cancer	DISDV4T7	Strong	Altered Expression	[5]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[5]
Gastric cancer	DISXGOUK	moderate	Altered Expression	[25]
Stomach cancer	DISKIJSX	moderate	Altered Expression	[25]
Cardiac disease	DISVO1I5	Disputed	Genetic Variation	[26]
Asthma	DISW9QNS	Limited	Altered Expression	[27]
Cardiac failure	DISDC067	Limited	Biomarker	[28]
Cardiovascular disease	DIS2IQDX	Limited	Biomarker	[29]
Congestive heart failure	DIS32MEA	Limited	Biomarker	[28]
Coronary heart disease	DIS5OIP1	Limited	Biomarker	[21]
Glioblastoma multiforme	DISK8246	Limited	Altered Expression	[30]
Renal cell carcinoma	DISQZ2X8	Limited	Biomarker	[31]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of FSD1-like protein (FSD1L).	[32]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of FSD1-like protein (FSD1L).	[33]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of FSD1-like protein (FSD1L).	[34]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of FSD1-like protein (FSD1L).	[35]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of FSD1-like protein (FSD1L).	[36]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of FSD1-like protein (FSD1L).	[37]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of FSD1-like protein (FSD1L).	[39]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of FSD1-like protein (FSD1L).	[40]
PMID28870136-Compound-48	DMPIM9L	Patented	PMID28870136-Compound-48 increases the expression of FSD1-like protein (FSD1L).	[41]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of FSD1-like protein (FSD1L).	[42]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of FSD1-like protein (FSD1L).	[43]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of FSD1-like protein (FSD1L).	[44]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of FSD1-like protein (FSD1L).	[45]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of FSD1-like protein (FSD1L).	[38]

References

• [1] Upregulation of miR-133b and miR-328 in Patients With Atrial Dilatation: Implications for Stretch-Induced Atrial Fibrillation.Front Physiol. 2019 Sep 10;10:1133. doi: 10.3389/fphys.2019.01133. eCollection 2019.
• [2] Circulating myocardial microRNAs from infarcted hearts are carried in exosomes and mobilise bone marrow progenitor cells.Nat Commun. 2019 Feb 27;10(1):959. doi: 10.1038/s41467-019-08895-7.
• [3] miR-1-3p suppresses proliferation of hepatocellular carcinoma through targeting SOX9.Onco Targets Ther. 2019 Mar 22;12:2149-2157. doi: 10.2147/OTT.S197326. eCollection 2019.
• [4] Obesity-associated alterations in cardiac connexin-43 and PKC signaling are attenuated by melatonin and omega-3 fatty acids in female rats.Mol Cell Biochem. 2019 Apr;454(1-2):191-202. doi: 10.1007/s11010-018-3463-0. Epub 2018 Nov 16.
• [5] MiR-1-3p inhibits cell proliferation and invasion by regulating BDNF-TrkB signaling pathway in bladder cancer.Neoplasma. 2018;65(1):89-96. doi: 10.4149/neo_2018_161128N594.
• [6] MiR-1 Suppresses Proliferation of Osteosarcoma Cells by Up-regulating p21 via PAX3.Cancer Genomics Proteomics. 2019 Jan-Feb;16(1):71-79. doi: 10.21873/cgp.20113.
• [7] Identification of microRNA expression in sentinel lymph nodes from patients with breast cancer via RNA sequencing for diagnostic accuracy.J Gene Med. 2019 Apr;21(4):e3075. doi: 10.1002/jgm.3075. Epub 2019 Mar 3.
• [8] Role of miR-1 expression in clear cell renal cell carcinoma (ccRCC): A bioinformatics study based on GEO, ArrayExpress microarrays and TCGA database.Pathol Res Pract. 2018 Feb;214(2):195-206. doi: 10.1016/j.prp.2017.11.025. Epub 2017 Dec 2.
• [9] PTBP1-associated microRNA-1 and -133b suppress the Warburg effect in colorectal tumors.Oncotarget. 2016 Apr 5;7(14):18940-52. doi: 10.18632/oncotarget.8005.
• [10] miR-16 rescues F508del-CFTR function in native cystic fibrosis epithelial cells.Gene Ther. 2015 Nov;22(11):908-16. doi: 10.1038/gt.2015.56. Epub 2015 Jul 2.
• [11] Liver X receptor is targeted by microRNA-1 to inhibit cardiomyocyte apoptosis through a ROS-mediated mitochondrial pathway.Biochem Cell Biol. 2018 Feb;96(1):11-18. doi: 10.1139/bcb-2017-0154. Epub 2017 Oct 12.
• [12] Uniform sarcolemmal dystrophin expression is required to prevent extracellular microRNA release and improve dystrophic pathology.J Cachexia Sarcopenia Muscle. 2020 Apr;11(2):578-593. doi: 10.1002/jcsm.12506. Epub 2019 Dec 17.
• [13] MicroRNA-1 inhibits ovarian cancer cell proliferation and migration through c-Met pathway.Clin Chim Acta. 2017 Oct;473:237-244. doi: 10.1016/j.cca.2017.07.008. Epub 2017 Jul 8.
• [14] microRNA-messenger RNA regulatory network of esophageal squamous cell carcinoma and the identification of miR-1 as a biomarker of patient survival.J Cell Biochem. 2019 Aug;120(8):12259-12272. doi: 10.1002/jcb.28166. Epub 2019 Apr 24.
• [15] Dual-receptor (EGFR and c-MET) inhibition by tumor-suppressive miR-1 and miR-206 in head and neck squamous cell carcinoma.J Hum Genet. 2017 Jan;62(1):113-121. doi: 10.1038/jhg.2016.47. Epub 2016 May 12.
• [16] miR-1 is increased in pulmonary hypertension and downregulates Kv1.5 channels in rat pulmonary arteries.J Physiol. 2019 Feb;597(4):1185-1197. doi: 10.1113/JP276054. Epub 2018 Jun 21.
• [17] miR-1-3p and miR-206 sensitizes HGF-induced gefitinib-resistant human lung cancer cells through inhibition of c-Met signalling and EMT.J Cell Mol Med. 2018 Jul;22(7):3526-3536. doi: 10.1111/jcmm.13629. Epub 2018 Apr 17.
• [18] ADAM9 enhances CDCP1 by inhibiting miR-1 through EGFR signaling activation in lung cancer metastasis.Oncotarget. 2017 Jul 18;8(29):47365-47378. doi: 10.18632/oncotarget.17648.
• [19] MicroRNA? downregulation induced by carvedilol protects cardiomyocytes against apoptosis by targeting heat shock protein 60.Mol Med Rep. 2019 May;19(5):3527-3536. doi: 10.3892/mmr.2019.10034. Epub 2019 Mar 14.
• [20] The role of MALAT1/miR-1/slug axis on radioresistance in nasopharyngeal carcinoma.Tumour Biol. 2016 Mar;37(3):4025-33. doi: 10.1007/s13277-015-4227-z. Epub 2015 Oct 20.
• [21] Upregulation of Circulating Cardiomyocyte-Enriched miR-1 and miR-133 Associate with the Risk of Coronary Artery Disease in Type 2 Diabetes Patients and Serve as Potential Biomarkers.J Cardiovasc Transl Res. 2019 Aug;12(4):347-357. doi: 10.1007/s12265-018-9857-2. Epub 2019 Jan 4.
• [22] Long noncoding RNA RMRP promotes proliferation and invasion via targeting miR-1-3p in non-small-cell lung cancer.J Cell Biochem. 2019 Sep;120(9):15170-15181. doi: 10.1002/jcb.28779. Epub 2019 May 3.
• [23] Downregulation of miR-1 enhances tumorigenicity and invasiveness in oral squamous cell carcinomas.J Formos Med Assoc. 2017 Oct;116(10):782-789. doi: 10.1016/j.jfma.2016.12.003. Epub 2017 Jan 12.
• [24] The long non-coding RNA HOTAIR promotes thyroid cancer cell growth, invasion and migration through the miR-1-CCND2 axis.Am J Cancer Res. 2017 Jun 1;7(6):1298-1309. eCollection 2017.
• [25] MiR-1-3p suppresses cell proliferation and invasion and targets STC2 in gastric cancer.Eur Rev Med Pharmacol Sci. 2019 Oct;23(20):8870-8877. doi: 10.26355/eurrev_201910_19282.
• [26] Circulating MicroRNA in patients with repaired tetralogy of Fallot.Eur J Clin Invest. 2017 Aug;47(8):574-582. doi: 10.1111/eci.12778. Epub 2017 Jul 18.
• [27] The Clinical Significance of Changes in the Expression Levels of MicroRNA-1 and Inflammatory Factors in the Peripheral Blood of Children with Acute-Stage Asthma.Biomed Res Int. 2018 Jun 26;2018:7632487. doi: 10.1155/2018/7632487. eCollection 2018.
• [28] MiR-1a-3p mitigates isoproterenol-induced heart failure by enhancing the expression of mitochondrial ND1 and COX1.Exp Cell Res. 2019 May 1;378(1):87-97. doi: 10.1016/j.yexcr.2019.03.012. Epub 2019 Mar 7.
• [29] MicroRNA?4a mediates atrial fibrillation through regulation of AnkyrinB expression.Mol Med Rep. 2018 Jun;17(6):8457-8465. doi: 10.3892/mmr.2018.8873. Epub 2018 Apr 12.
• [30] MicroRNA-1 suppresses glioblastoma in preclinical models by targeting fibronectin.Cancer Lett. 2019 Nov 28;465:59-67. doi: 10.1016/j.canlet.2019.08.021. Epub 2019 Sep 3.
• [31] miR-1-3p suppresses the epithelial-mesenchymal transition property in renal cell cancer by downregulating Fibronectin 1.Cancer Manag Res. 2019 Jun 21;11:5573-5587. doi: 10.2147/CMAR.S200707. eCollection 2019.
• [32] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [33] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [34] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [35] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [36] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [37] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [38] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [39] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [40] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [41] Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
• [42] Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
• [43] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [44] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [45] Persistence of epigenomic effects after recovery from repeated treatment with two nephrocarcinogens. Front Genet. 2018 Dec 3;9:558.