Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTF456VC)

• DOT Name: Disabled homolog 2-interacting protein (DAB2IP)
• Synonyms: DAB2 interaction protein; DAB2-interacting protein; ASK-interacting protein 1; AIP-1; DOC-2/DAB-2 interactive protein
• Gene Name: DAB2IP
• Related Disease:
  Lung neoplasm
  Urinary bladder cancer
  Urinary bladder neoplasm
  Amyloidosis
  Bladder cancer
  Breast neoplasm
  Cardiovascular disease
  Cholangiocarcinoma
  Clear cell renal carcinoma
  Colorectal carcinoma
  Coronary atherosclerosis
  Coronary heart disease
  Endometrial cancer
  Endometrial carcinoma
  Esophageal squamous cell carcinoma
  Inflammatory bowel disease
  Lung cancer
  Lung carcinoma
  Medulloblastoma
  Metastatic malignant neoplasm
  Metastatic prostate carcinoma
  Non-small-cell lung cancer
  Pancreatic cancer
  Prostate carcinoma
  Prostate neoplasm
  Renal cell carcinoma
  Transitional cell carcinoma
  Urothelial carcinoma
  Atherosclerosis
  Breast cancer
  Breast carcinoma
  Gastric cancer
  Melanoma
  Stomach cancer
  Abdominal aortic aneurysm
  Arteriosclerosis
  Bone osteosarcoma
  Castration-resistant prostate carcinoma
  Chronic obstructive pulmonary disease
  Myocardial infarction
  Nasopharyngeal carcinoma
  Osteosarcoma
  Peripheral vascular disease
  Prostate cancer
  Pulmonary embolism
• UniProt ID: DAB2P_HUMAN
• Pfam ID: PF00168 ; PF12004 ; PF00616
• Sequence:
  MSAGGSARKSTGRSSYYYRLLRRPRLQRQRSRSRSRTRPARESPQERPGSRRSLPGSLSE
  KSPSMEPSAATPFRVTGFLSRRLKGSIKRTKSQPKLDRNHSFRHILPGFRSAAAAAADNE
  RSHLMPRLKESRSHESLLSPSSAVEALDLSMEEEVVIKPVHSSILGQDYCFEVTTSSGSK
  CFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDV
  LYARTTGKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSYLGLVSLPAAS
  VAGRQFVEKWYPVVTPNPKGGKGPGPMIRIKARYQTITILPMEMYKEFAEHITNHYLGLC
  AALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATK
  AIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSKCSAADLPEHQGNLKMCCELAFC
  KIINSYCVFPRELKEVFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFNLLQ
  EYPDDRTARTLTLIAKVTQNLANFAKFGSKEEYMSFMNQFLEHEWTNMQRFLLEISNPET
  LSNTAGFEGYIDLGRELSSLHSLLWEAVSQLEQSIVSKLGPLPRILRDVHTALSTPGSGQ
  LPGTNDLASTPGSGSSSISAGLQKMVIENDLSGLIDFTRLPSPTPENKDLFFVTRSSGVQ
  PSPARSSSYSEANEPDLQMANGGKSLSMVDLQDARTLDGEAGSPAGPDVLPTDGQAAAAQ
  LVAGWPARATPVNLAGLATVRRAGQTPTTPGTSEGAPGRPQLLAPLSFQNPVYQMAAGLP
  LSPRGLGDSGSEGHSSLSSHSNSEELAAAAKLGSFSTAAEELARRPGELARRQMSLTEKG
  GQPTVPRQNSAGPQRRIDQPPPPPPPPPPAPRGRTPPNLLSTLQYPRPSSGTLASASPDW
  VGPSTRLRQQSSSSKGDSPELKPRAVHKQGPSPVSPNALDRTAAWLLTMNAQLLEDEGLG
  PDPPHRDRLRSKDELSQAEKDLAVLQDKLRISTKKLEEYETLFKCQEETTQKLVLEYQAR
  LEEGEERLRRQQEDKDIQMKGIISRLMSVEEELKKDHAEMQAAVDSKQKIIDAQEKRIAS
  LDAANARLMSALTQLKERYSMQARNGISPTNPTKLQITENGEFRNSSNC
• Function: Functions as a scaffold protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Involved in several processes such as innate immune response, inflammation and cell growth inhibition, apoptosis, cell survival, angiogenesis, cell migration and maturation. Also plays a role in cell cycle checkpoint control; reduces G1 phase cyclin levels resulting in G0/G1 cell cycle arrest. Mediates signal transduction by receptor-mediated inflammatory signals, such as the tumor necrosis factor (TNF), interferon (IFN) or lipopolysaccharide (LPS). Modulates the balance between phosphatidylinositol 3-kinase (PI3K)-AKT-mediated cell survival and apoptosis stimulated kinase (MAP3K5)-JNK signaling pathways; sequesters both AKT1 and MAP3K5 and counterbalances the activity of each kinase by modulating their phosphorylation status in response to pro-inflammatory stimuli. Acts as a regulator of the endoplasmic reticulum (ER) unfolded protein response (UPR) pathway; specifically involved in transduction of the ER stress-response to the JNK cascade through ERN1. Mediates TNF-alpha-induced apoptosis activation by facilitating dissociation of inhibitor 14-3-3 from MAP3K5; recruits the PP2A phosphatase complex which dephosphorylates MAP3K5 on 'Ser-966', leading to the dissociation of 13-3-3 proteins and activation of the MAP3K5-JNK signaling pathway in endothelial cells. Mediates also TNF/TRAF2-induced MAP3K5-JNK activation, while it inhibits CHUK-NF-kappa-B signaling. Acts a negative regulator in the IFN-gamma-mediated JAK-STAT signaling cascade by inhibiting smooth muscle cell (VSMCs) proliferation and intimal expansion, and thus, prevents graft arteriosclerosis (GA). Acts as a GTPase-activating protein (GAP) for the ADP ribosylation factor 6 (ARF6) and Ras. Promotes hydrolysis of the ARF6-bound GTP and thus, negatively regulates phosphatidylinositol 4,5-bisphosphate (PIP2)-dependent TLR4-TIRAP-MyD88 and NF-kappa-B signaling pathways in endothelial cells in response to lipopolysaccharides (LPS). Binds specifically to phosphatidylinositol 4-phosphate (PtdIns4P) and phosphatidylinositol 3-phosphate (PtdIns3P). In response to vascular endothelial growth factor (VEGFA), acts as a negative regulator of the VEGFR2-PI3K-mediated angiogenic signaling pathway by inhibiting endothelial cell migration and tube formation. In the developing brain, promotes both the transition from the multipolar to the bipolar stage and the radial migration of cortical neurons from the ventricular zone toward the superficial layer of the neocortex in a glial-dependent locomotion process. Probable downstream effector of the Reelin signaling pathway; promotes Purkinje cell (PC) dendrites development and formation of cerebellar synapses. Functions also as a tumor suppressor protein in prostate cancer progression; prevents cell proliferation and epithelial-to-mesenchymal transition (EMT) through activation of the glycogen synthase kinase-3 beta (GSK3B)-induced beta-catenin and inhibition of PI3K-AKT and Ras-MAPK survival downstream signaling cascades, respectively.
• Tissue Specificity: Expressed in endothelial and vascular smooth muscle cells (VSMCs). Expressed in prostate epithelial but poorly in prostate cancer cells. Poorly expressed in medulloblastoma cells compared to cerebellar precursor proliferating progenitor cells (at protein level). Low expression in prostate. Down-regulated in prostate cancer.
• KEGG Pathway:
  Apoptosis (hsa04210)
  TNF sig.ling pathway (hsa04668)
• Reactome Pathway: Regulation of RAS by GAPs (R-HSA-5658442)

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung neoplasm	DISVARNB	Definitive	Biomarker	[1]
Urinary bladder cancer	DISDV4T7	Definitive	Altered Expression	[2]
Urinary bladder neoplasm	DIS7HACE	Definitive	Altered Expression	[2]
Amyloidosis	DISHTAI2	Strong	Genetic Variation	[3]
Bladder cancer	DISUHNM0	Strong	Altered Expression	[2]
Breast neoplasm	DISNGJLM	Strong	Posttranslational Modification	[4]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[5]
Cholangiocarcinoma	DIS71F6X	Strong	Biomarker	[6]
Clear cell renal carcinoma	DISBXRFJ	Strong	Altered Expression	[7]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[8]
Coronary atherosclerosis	DISKNDYU	Strong	Genetic Variation	[9]
Coronary heart disease	DIS5OIP1	Strong	Genetic Variation	[10]
Endometrial cancer	DISW0LMR	Strong	Genetic Variation	[11]
Endometrial carcinoma	DISXR5CY	Strong	Genetic Variation	[11]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[12]
Inflammatory bowel disease	DISGN23E	Strong	Biomarker	[13]
Lung cancer	DISCM4YA	Strong	Biomarker	[14]
Lung carcinoma	DISTR26C	Strong	Biomarker	[14]
Medulloblastoma	DISZD2ZL	Strong	Biomarker	[15]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[16]
Metastatic prostate carcinoma	DISVBEZ9	Strong	Altered Expression	[17]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[14]
Pancreatic cancer	DISJC981	Strong	Biomarker	[18]
Prostate carcinoma	DISMJPLE	Strong	Genetic Variation	[19]
Prostate neoplasm	DISHDKGQ	Strong	Genetic Variation	[20]
Renal cell carcinoma	DISQZ2X8	Strong	Altered Expression	[7]
Transitional cell carcinoma	DISWVVDR	Strong	Altered Expression	[21]
Urothelial carcinoma	DISRTNTN	Strong	Altered Expression	[21]
Atherosclerosis	DISMN9J3	moderate	Altered Expression	[22]
Breast cancer	DIS7DPX1	moderate	Genetic Variation	[23]
Breast carcinoma	DIS2UE88	moderate	Genetic Variation	[23]
Gastric cancer	DISXGOUK	moderate	Biomarker	[24]
Melanoma	DIS1RRCY	moderate	Genetic Variation	[23]
Stomach cancer	DISKIJSX	moderate	Biomarker	[24]
Abdominal aortic aneurysm	DISD06OF	Limited	Altered Expression	[25]
Arteriosclerosis	DISK5QGC	Limited	Biomarker	[26]
Bone osteosarcoma	DIST1004	Limited	Biomarker	[27]
Castration-resistant prostate carcinoma	DISVGAE6	Limited	Altered Expression	[28]
Chronic obstructive pulmonary disease	DISQCIRF	Limited	Altered Expression	[29]
Myocardial infarction	DIS655KI	Limited	Biomarker	[30]
Nasopharyngeal carcinoma	DISAOTQ0	Limited	Biomarker	[31]
Osteosarcoma	DISLQ7E2	Limited	Biomarker	[27]
Peripheral vascular disease	DISXSU1Y	Limited	Biomarker	[30]
Prostate cancer	DISF190Y	Limited	Genetic Variation	[19]
Pulmonary embolism	DISJYP9B	Limited	Biomarker	[30]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Chlorothiazide	DMLHESP	Approved	Disabled homolog 2-interacting protein (DAB2IP) increases the Metabolic disorder ADR of Chlorothiazide.	[44]

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Disabled homolog 2-interacting protein (DAB2IP).	[32]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Disabled homolog 2-interacting protein (DAB2IP).	[33]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Disabled homolog 2-interacting protein (DAB2IP).	[34]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Disabled homolog 2-interacting protein (DAB2IP).	[35]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Disabled homolog 2-interacting protein (DAB2IP).	[37]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Disabled homolog 2-interacting protein (DAB2IP).	[38]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol affects the expression of Disabled homolog 2-interacting protein (DAB2IP).	[39]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Disabled homolog 2-interacting protein (DAB2IP).	[41]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Disabled homolog 2-interacting protein (DAB2IP).	[42]

5 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Quercetin	DM3NC4M	Approved	Quercetin increases the phosphorylation of Disabled homolog 2-interacting protein (DAB2IP).	[36]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Disabled homolog 2-interacting protein (DAB2IP).	[40]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Disabled homolog 2-interacting protein (DAB2IP).	[36]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of Disabled homolog 2-interacting protein (DAB2IP).	[36]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid decreases the phosphorylation of Disabled homolog 2-interacting protein (DAB2IP).	[43]

References

• [1] A common genetic variant (97906C>A) of DAB2IP/AIP1 is associated with an increased risk and early onset of lung cancer in Chinese males.PLoS One. 2011;6(10):e26944. doi: 10.1371/journal.pone.0026944. Epub 2011 Oct 26.
• [2] Estrogen receptor promotes bladder cancer growth and invasion via alteration of miR-92a/DAB2IP signals.Exp Mol Med. 2018 Nov 20;50(11):1-11. doi: 10.1038/s12276-018-0155-5.
• [3] Antiamyloidogenic Activity of A42-Binding Peptoid in Modulating Amyloid Oligomerization.Small. 2017 Jan;13(1). doi: 10.1002/smll.201602857. Epub 2016 Oct 7.
• [4] Aberrant promoter methylation in human DAB2 interactive protein (hDAB2IP) gene in breast cancer.Clin Cancer Res. 2004 Mar 15;10(6):2082-9. doi: 10.1158/1078-0432.ccr-03-0236.
• [5] AIP1-mediated stress signaling in atherosclerosis and arteriosclerosis.Curr Atheroscler Rep. 2015 May;17(5):503. doi: 10.1007/s11883-015-0503-z.
• [6] Outcome and Genetic Factors in IgG4-Associated Autoimmune Pancreatitis and Cholangitis: A Single Center Experience.Gastroenterol Res Pract. 2017;2017:6126707. doi: 10.1155/2017/6126707. Epub 2017 Mar 2.
• [7] Downregulation of Human DAB2IP Gene Expression in Renal Cell Carcinoma Results in Resistance to Ionizing Radiation.Clin Cancer Res. 2019 Jul 15;25(14):4542-4551. doi: 10.1158/1078-0432.CCR-18-3004. Epub 2019 Apr 18.
• [8] miR-182 contributes to cell proliferation, invasion and tumor growth in colorectal cancer by targeting DAB2IP.Int J Biochem Cell Biol. 2019 Jun;111:27-36. doi: 10.1016/j.biocel.2019.04.002. Epub 2019 Apr 8.
• [9] Association of the single nucleotide polymorphism in chromosome 9p21 and chromosome 9q33 with coronary artery disease in Chinese population.BMC Cardiovasc Disord. 2017 Sep 30;17(1):255. doi: 10.1186/s12872-017-0685-0.
• [10] Identification of 64 Novel Genetic Loci Provides an Expanded View on the Genetic Architecture of Coronary Artery Disease.Circ Res. 2018 Feb 2;122(3):433-443. doi: 10.1161/CIRCRESAHA.117.312086. Epub 2017 Dec 6.
• [11] A mononucleotide repeat in PRRT2 is an important, frequent target of mismatch repair deficiency in cancer.Oncotarget. 2017 Jan 24;8(4):6043-6056. doi: 10.18632/oncotarget.13464.
• [12] Low expression level of ASK1-interacting protein-1 correlated with tumor angiogenesis and poor survival in patients with esophageal squamous cell cancer.Onco Targets Ther. 2018 Nov 1;11:7699-7707. doi: 10.2147/OTT.S178131. eCollection 2018.
• [13] Suppression of inflammation and tissue damage by a hookworm recombinant protein in experimental colitis.Clin Transl Immunology. 2017 Oct 6;6(10):e157. doi: 10.1038/cti.2017.42. eCollection 2017 Oct.
• [14] Low Expression of ASK1-Interacting Protein-1 Is Significantly Correlated with Tumor Angiogenesis and Poor Survival in Patients with Early Stage Non-Small Cell Lung Cancer.Onco Targets Ther. 2019 Dec 10;12:10739-10747. doi: 10.2147/OTT.S222332. eCollection 2019.
• [15] EZH2-regulated DAB2IP is a medulloblastoma tumor suppressor and a positive marker for survival.Clin Cancer Res. 2012 Aug 1;18(15):4048-58. doi: 10.1158/1078-0432.CCR-12-0399. Epub 2012 Jun 13.
• [16] Role of DAB2IP in modulating epithelial-to-mesenchymal transition and prostate cancer metastasis.Proc Natl Acad Sci U S A. 2010 Feb 9;107(6):2485-90. doi: 10.1073/pnas.0908133107. Epub 2010 Jan 13.
• [17] DAB2IP coordinates both PI3K-Akt and ASK1 pathways for cell survival and apoptosis.Proc Natl Acad Sci U S A. 2009 Nov 24;106(47):19878-83. doi: 10.1073/pnas.0908458106. Epub 2009 Nov 10.
• [18] Decreased expression of DAB2IP in pancreatic cancer with wild-type KRAS.Hepatobiliary Pancreat Dis Int. 2013 Apr;12(2):204-9. doi: 10.1016/s1499-3872(13)60032-6.
• [19] A potential clinical significance of DAB2IP and SPRY2 transcript variants in prostate cancer.Pathol Res Pract. 2018 Dec;214(12):2018-2024. doi: 10.1016/j.prp.2018.09.019. Epub 2018 Sep 29.
• [20] Two genome-wide association studies of aggressive prostate cancer implicate putative prostate tumor suppressor gene DAB2IP.J Natl Cancer Inst. 2007 Dec 19;99(24):1836-44. doi: 10.1093/jnci/djm250. Epub 2007 Dec 11.
• [21] Low expression of DAB2IP predicts an unfavorable prognosis in human bladder carcinoma.Onco Targets Ther. 2017 Nov 29;10:5719-5726. doi: 10.2147/OTT.S146952. eCollection 2017.
• [22] Endothelial AIP1 Regulates Vascular Remodeling by Suppressing NADPH Oxidase-2.Front Physiol. 2018 Apr 20;9:396. doi: 10.3389/fphys.2018.00396. eCollection 2018.
• [23] AIP1 Expression in Tumor Niche Suppresses Tumor Progression and Metastasis.Cancer Res. 2015 Sep 1;75(17):3492-504. doi: 10.1158/0008-5472.CAN-15-0088. Epub 2015 Jul 2.
• [24] miR-92b promotes gastric cancer growth by activating the DAB2IP-mediated PI3K/AKT signalling pathway.Cell Prolif. 2020 Jan;53(1):e12630. doi: 10.1111/cpr.12630. Epub 2019 Nov 12.
• [25] DAB2IP Expression in Abdominal Aortic Aneurysm: EZH2 and mir-363-3p as Potential Mediators.In Vivo. 2019 May-Jun;33(3):737-742. doi: 10.21873/invivo.11533.
• [26] Short AIP1 (ASK1-Interacting Protein-1) Isoform Localizes to the Mitochondria and Promotes Vascular Dysfunction.Arterioscler Thromb Vasc Biol. 2020 Jan;40(1):112-127. doi: 10.1161/ATVBAHA.119.312976. Epub 2019 Oct 17.
• [27] Disabled homolog 2 interactive protein functions as a tumor suppressor in osteosarcoma cells.Oncol Lett. 2018 Jul;16(1):703-712. doi: 10.3892/ol.2018.8776. Epub 2018 May 22.
• [28] The mechanism of DAB2IP in chemoresistance of prostate cancer cells.Clin Cancer Res. 2013 Sep 1;19(17):4740-9. doi: 10.1158/1078-0432.CCR-13-0954. Epub 2013 Jul 9.
• [29] Cigarette smoke affects the onco-suppressor DAB2IP expression in bronchial epithelial cells of COPD patients.Sci Rep. 2019 Oct 30;9(1):15682. doi: 10.1038/s41598-019-52179-5.
• [30] Genome-wide association study identifies a sequence variant within the DAB2IP gene conferring susceptibility to abdominal aortic aneurysm.Nat Genet. 2010 Aug;42(8):692-7. doi: 10.1038/ng.622. Epub 2010 Jul 11.
• [31] DOC-2/DAB2 interactive protein regulates proliferation and mobility of nasopharyngeal carcinoma cells by targeting PI3K/Akt pathway.Oncol Rep. 2017 Jul;38(1):317-324. doi: 10.3892/or.2017.5704. Epub 2017 Jun 6.
• [32] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [33] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [34] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [35] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [36] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [37] Chronic occupational exposure to arsenic induces carcinogenic gene signaling networks and neoplastic transformation in human lung epithelial cells. Toxicol Appl Pharmacol. 2012 Jun 1;261(2):204-16.
• [38] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [39] The genomic response of a human uterine endometrial adenocarcinoma cell line to 17alpha-ethynyl estradiol. Toxicol Sci. 2009 Jan;107(1):40-55.
• [40] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [41] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [42] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
• [43] Functional lipidomics: Palmitic acid impairs hepatocellular carcinoma development by modulating membrane fluidity and glucose metabolism. Hepatology. 2017 Aug;66(2):432-448. doi: 10.1002/hep.29033. Epub 2017 Jun 16.
• [44] Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans. Pharmacogenomics J. 2014 Feb;14(1):35-40. doi: 10.1038/tpj.2013.3. Epub 2013 Feb 12.