Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTF5HTYL)

• DOT Name: D-dopachrome decarboxylase (DDT)
• Synonyms: EC 4.1.1.84; D-dopachrome tautomerase; Phenylpyruvate tautomerase II
• Gene Name: DDT
• Related Disease:
  Acute myelogenous leukaemia
  Advanced cancer
  Al amyloidosis
  Atrial fibrillation
  Autism spectrum disorder
  Bronchopulmonary dysplasia
  Burkitt lymphoma
  Cardiac failure
  Cardiovascular disease
  Cervical cancer
  Cervical carcinoma
  Congestive heart failure
  Depression
  Diabetic kidney disease
  Dowling-Degos disease
  Endometrial cancer
  Endometrial carcinoma
  Kidney cancer
  Major depressive disorder
  Malaria
  Multiple sclerosis
  Myocardial infarction
  Neoplasm
  Non-small-cell lung cancer
  Pneumonia
  Renal carcinoma
  Renal cell carcinoma
  Respiratory disease
  Systemic lupus erythematosus
  Type-1/2 diabetes
  Visceral leishmaniasis
  Isolated congenital microcephaly
  Pancreatic cancer
  Leishmaniasis
  Non-insulin dependent diabetes
  Thyroid cancer
  Thyroid gland carcinoma
  Thyroid tumor
  Adenocarcinoma
  Aplasia cutis congenita
  Breast cancer
  Breast carcinoma
  Chronic kidney disease
  Corpus callosum, agenesis of
  Female hypogonadism
  Neuroblastoma
  Obesity
• UniProt ID: DOPD_HUMAN
• PDB ID: 1DPT; 3KAN; 4Q3F; 6C5F; 7MRU; 7MRV; 7MSE; 7MW7; 8DBB
• EC Number: 4.1.1.84
• Pfam ID: PF01187
• Sequence:
  MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQL
  SISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
• Function: Tautomerization of D-dopachrome with decarboxylation to give 5,6-dihydroxyindole (DHI).
• Tissue Specificity: Highly expressed in the liver and at lower levels in the heart, lung and pancreas.

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute myelogenous leukaemia	DISCSPTN	Strong	Genetic Variation	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Al amyloidosis	DISMHVSL	Strong	Biomarker	[3]
Atrial fibrillation	DIS15W6U	Strong	Altered Expression	[4]
Autism spectrum disorder	DISXK8NV	Strong	Biomarker	[5]
Bronchopulmonary dysplasia	DISO0BY5	Strong	Genetic Variation	[6]
Burkitt lymphoma	DIS9D5XU	Strong	Genetic Variation	[7]
Cardiac failure	DISDC067	Strong	Altered Expression	[8]
Cardiovascular disease	DIS2IQDX	Strong	Altered Expression	[9]
Cervical cancer	DISFSHPF	Strong	Biomarker	[10]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[10]
Congestive heart failure	DIS32MEA	Strong	Altered Expression	[8]
Depression	DIS3XJ69	Strong	Biomarker	[11]
Diabetic kidney disease	DISJMWEY	Strong	Biomarker	[12]
Dowling-Degos disease	DISGTTEP	Strong	Biomarker	[13]
Endometrial cancer	DISW0LMR	Strong	Biomarker	[14]
Endometrial carcinoma	DISXR5CY	Strong	Biomarker	[14]
Kidney cancer	DISBIPKM	Strong	Biomarker	[15]
Major depressive disorder	DIS4CL3X	Strong	Biomarker	[11]
Malaria	DISQ9Y50	Strong	Biomarker	[16]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[17]
Myocardial infarction	DIS655KI	Strong	Altered Expression	[18]
Neoplasm	DISZKGEW	Strong	Biomarker	[10]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[19]
Pneumonia	DIS8EF3M	Strong	Altered Expression	[4]
Renal carcinoma	DISER9XT	Strong	Biomarker	[15]
Renal cell carcinoma	DISQZ2X8	Strong	Altered Expression	[15]
Respiratory disease	DISGGAGJ	Strong	Biomarker	[20]
Systemic lupus erythematosus	DISI1SZ7	Strong	Altered Expression	[21]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[2]
Visceral leishmaniasis	DISTKEYK	Strong	Genetic Variation	[22]
Isolated congenital microcephaly	DISUXHZ6	moderate	Altered Expression	[23]
Pancreatic cancer	DISJC981	moderate	Biomarker	[24]
Leishmaniasis	DISABTW7	Disputed	Biomarker	[25]
Non-insulin dependent diabetes	DISK1O5Z	Disputed	Genetic Variation	[26]
Thyroid cancer	DIS3VLDH	Disputed	Biomarker	[27]
Thyroid gland carcinoma	DISMNGZ0	Disputed	Biomarker	[27]
Thyroid tumor	DISLVKMD	Disputed	Biomarker	[27]
Adenocarcinoma	DIS3IHTY	Limited	Altered Expression	[28]
Aplasia cutis congenita	DISMDAYM	Limited	Biomarker	[29]
Breast cancer	DIS7DPX1	Limited	Biomarker	[30]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[30]
Chronic kidney disease	DISW82R7	Limited	Biomarker	[31]
Corpus callosum, agenesis of	DISO9P40	Limited	Biomarker	[29]
Female hypogonadism	DISWASB4	Limited	Biomarker	[32]
Neuroblastoma	DISVZBI4	Limited	Biomarker	[33]
Obesity	DIS47Y1K	Limited	Biomarker	[2]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Amphotericin B	DMTAJQE	Approved	D-dopachrome decarboxylase (DDT) increases the Cell death ADR of Amphotericin B.	[47]
Deoxycholic acid	DM3GYAL	Approved	D-dopachrome decarboxylase (DDT) increases the Cell death ADR of Deoxycholic acid.	[47]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of D-dopachrome decarboxylase (DDT).	[34]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of D-dopachrome decarboxylase (DDT).	[35]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of D-dopachrome decarboxylase (DDT).	[36]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of D-dopachrome decarboxylase (DDT).	[37]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of D-dopachrome decarboxylase (DDT).	[38]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of D-dopachrome decarboxylase (DDT).	[39]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of D-dopachrome decarboxylase (DDT).	[40]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of D-dopachrome decarboxylase (DDT).	[41]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of D-dopachrome decarboxylase (DDT).	[42]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of D-dopachrome decarboxylase (DDT).	[43]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the expression of D-dopachrome decarboxylase (DDT).	[44]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of D-dopachrome decarboxylase (DDT).	[35]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of D-dopachrome decarboxylase (DDT).	[45]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of D-dopachrome decarboxylase (DDT).	[46]

References

• [1] Pre-diagnostic serum concentrations of organochlorines and risk of acute myeloid leukemia: A nested case-control study in the Norwegian Janus Serum Bank Cohort.Environ Int. 2019 Apr;125:229-235. doi: 10.1016/j.envint.2019.01.066. Epub 2019 Feb 2.
• [2] Oxidative Phosphorylation Impairment by DDT and DDE.Front Endocrinol (Lausanne). 2019 Mar 12;10:122. doi: 10.3389/fendo.2019.00122. eCollection 2019.
• [3] Optimal conditions and the advantages of using laser microdissection and liquid chromatography tandem mass spectrometry for diagnosing renal amyloidosis.Clin Exp Nephrol. 2018 Aug;22(4):871-880. doi: 10.1007/s10157-018-1533-y. Epub 2018 Jan 25.
• [4] Interaction of MIF Family Proteins in Myocardial Ischemia/Reperfusion Damage and Their Influence on Clinical Outcome of Cardiac Surgery Patients.Antioxid Redox Signal. 2015 Oct 10;23(11):865-79. doi: 10.1089/ars.2014.6243. Epub 2015 Aug 11.
• [5] The association of environmental toxicants and autism spectrum disorders in children.Environ Pollut. 2017 Aug;227:234-242. doi: 10.1016/j.envpol.2017.04.039. Epub 2017 May 2.
• [6] Plasma Levels of Macrophage Migration Inhibitory Factor and d-Dopachrome Tautomerase Show a Highly Specific Profile in Early Life.Front Immunol. 2017 Jan 25;8:26. doi: 10.3389/fimmu.2017.00026. eCollection 2017.
• [7] Multiprotein complexes present at the MIF motifs flanking the promoter of the human c-myc gene.FEBS Lett. 2000 May 26;474(1):23-8. doi: 10.1016/s0014-5793(00)01562-3.
• [8] Cardiomyocyte d-dopachrome tautomerase protects against heart failure.JCI Insight. 2019 Sep 5;4(17):e128900. doi: 10.1172/jci.insight.128900.
• [9] MIF family cytokines in cardiovascular diseases and prospects for precision-based therapeutics.Expert Opin Ther Targets. 2017 Jul;21(7):671-683. doi: 10.1080/14728222.2017.1336227.
• [10] Combined Knockdown of D-dopachrome Tautomerase and Migration Inhibitory Factor Inhibits the Proliferation, Migration, and Invasion in Human Cervical Cancer.Int J Gynecol Cancer. 2017 May;27(4):634-642. doi: 10.1097/IGC.0000000000000951.
• [11] Pathogenic contribution of the Macrophage migration inhibitory factor family to major depressive disorder and emerging tailored therapeutic approaches.J Affect Disord. 2020 Feb 15;263:15-24. doi: 10.1016/j.jad.2019.11.127. Epub 2019 Nov 30.
• [12] Exposure to DDT and diabetic nephropathy among Mexican Americans in the 1999-2004 National Health and Nutrition Examination Survey.Environ Pollut. 2017 Mar;222:132-137. doi: 10.1016/j.envpol.2016.12.069. Epub 2017 Jan 5.
• [13] Associations between DDT and egg parameters of the House Sparrow Passer domesticus from the Thohoyandou area of South Africa.Chemosphere. 2018 May;198:249-256. doi: 10.1016/j.chemosphere.2018.01.125. Epub 2018 Feb 6.
• [14] Gene expression profiling in Ishikawa cells: a fingerprint for estrogen active compounds. Toxicol Appl Pharmacol. 2009 Apr 1;236(1):85-96.
• [15] Dysregulated D-dopachrome tautomerase, a hypoxia-inducible factor-dependent gene, cooperates with macrophage migration inhibitory factor in renal tumorigenesis.J Biol Chem. 2014 Feb 7;289(6):3713-23. doi: 10.1074/jbc.M113.500694. Epub 2013 Dec 19.
• [16] Cytochrome P450 Mono-Oxygenase and Resistance Phenotype in DDT and Deltamethrin-Resistant Anopheles gambiae (Diptera: Culicidae) and Culex quinquefasciatus in Kosofe, Lagos, Nigeria.J Med Entomol. 2019 Apr 16;56(3):817-821. doi: 10.1093/jme/tjz006.
• [17] Increased CD74 binding and EAE treatment efficacy of a modified DR1 molecular construct.Metab Brain Dis. 2019 Feb;34(1):153-164. doi: 10.1007/s11011-018-0331-2. Epub 2018 Oct 23.
• [18] Macrophage Migration Inhibitory Factor (MIF) Expression Increases during Myocardial Infarction and Supports Pro-Inflammatory Signaling in Cardiac Fibroblasts.Biomolecules. 2019 Jan 23;9(2):38. doi: 10.3390/biom9020038.
• [19] Negative regulation of AMP-activated protein kinase (AMPK) activity by macrophage migration inhibitory factor (MIF) family members in non-small cell lung carcinomas.J Biol Chem. 2012 Nov 2;287(45):37917-25. doi: 10.1074/jbc.M112.378299. Epub 2012 Sep 17.
• [20] Role of MIF and D-DT in immune-inflammatory, autoimmune, and chronic respiratory diseases: from pathogenic factors to therapeutic targets.Drug Discov Today. 2019 Feb;24(2):428-439. doi: 10.1016/j.drudis.2018.11.003. Epub 2018 Nov 13.
• [21] Analysis of serum macrophage migration inhibitory factor and D-dopachrome tautomerase in systemic sclerosis.Clin Transl Immunology. 2018 Dec 6;7(12):e1042. doi: 10.1002/cti2.1042. eCollection 2018.
• [22] Knockdown resistance mutations predict DDT resistance and pyrethroid tolerance in the visceral leishmaniasis vector Phlebotomus argentipes.PLoS Negl Trop Dis. 2017 Apr 17;11(4):e0005504. doi: 10.1371/journal.pntd.0005504. eCollection 2017 Apr.
• [23] Contamination Profile of DDTs in the Shark Somniosus microcephalus from Greenland Seawaters.Bull Environ Contam Toxicol. 2018 Jul;101(1):7-13. doi: 10.1007/s00128-018-2371-z. Epub 2018 May 29.
• [24] Serum concentrations of organochlorine compounds and K-ras mutations in exocrine pancreatic cancer. PANKRAS II Study Group.Lancet. 1999 Dec 18-25;354(9196):2125-9. doi: 10.1016/s0140-6736(99)04232-4.
• [25] Global trends in the production and use of DDT for control of malaria and other vector-borne diseases.Malar J. 2017 Oct 5;16(1):401. doi: 10.1186/s12936-017-2050-2.
• [26] Characterization of Large Copy Number Variation in Mexican Type 2 Diabetes subjects.Sci Rep. 2017 Dec 6;7(1):17105. doi: 10.1038/s41598-017-17361-7.
• [27] A nested case-control study of polychlorinated biphenyls, organochlorine pesticides, and thyroid cancer in the Janus Serum Bank cohort.Environ Res. 2018 Aug;165:125-132. doi: 10.1016/j.envres.2018.04.012. Epub 2018 Apr 23.
• [28] Cooperative regulation of non-small cell lung carcinoma angiogenic potential by macrophage migration inhibitory factor and its homolog, D-dopachrome tautomerase.J Immunol. 2008 Aug 15;181(4):2330-7. doi: 10.4049/jimmunol.181.4.2330.
• [29] Exquisite sensitivity of adrenocortical carcinomas to induction of ferroptosis.Proc Natl Acad Sci U S A. 2019 Oct 29;116(44):22269-22274. doi: 10.1073/pnas.1912700116. Epub 2019 Oct 14.
• [30] DDT and Breast Cancer: Prospective Study of Induction Time and Susceptibility Windows.J Natl Cancer Inst. 2019 Aug 1;111(8):803-810. doi: 10.1093/jnci/djy198.
• [31] High serum levels of p,p'-DDE are associated with an accelerated decline in GFR during 10years follow-up.Sci Total Environ. 2018 Dec 10;644:371-374. doi: 10.1016/j.scitotenv.2018.07.020. Epub 2018 Jul 5.
• [32] Selected persistent organic pollutants associated with the risk of primary ovarian insufficiency in women.Environ Int. 2019 Aug;129:51-58. doi: 10.1016/j.envint.2019.05.023. Epub 2019 May 17.
• [33] Overexpression of Macrophage Migration Inhibitory Factor and Its Homologue D-Dopachrome Tautomerase as Negative Prognostic Factor in Neuroblastoma.Brain Sci. 2019 Oct 19;9(10):284. doi: 10.3390/brainsci9100284.
• [34] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [35] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [36] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [37] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [38] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [39] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [40] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [41] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [42] Cannabidiol Modulates the Immunophenotype and Inhibits the Activation of the Inflammasome in Human Gingival Mesenchymal Stem Cells. Front Physiol. 2016 Nov 24;7:559. doi: 10.3389/fphys.2016.00559. eCollection 2016.
• [43] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [44] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
• [45] Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
• [46] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [47] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.