Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFJMXPM)

DOT Name Cadherin-1 (CDH1)
Synonyms CAM 120/80; Epithelial cadherin; E-cadherin; Uvomorulin; CD antigen CD324
Gene Name CDH1
Related Disease
Blepharocheilodontic syndrome 1 ( )
CDH1-related diffuse gastric and lobular breast cancer syndrome ( )
Hereditary breast carcinoma ( )
Hereditary diffuse gastric adenocarcinoma ( )
Cleft soft palate ( )
Blepharocheilodontic syndrome ( )
Familial ovarian cancer ( )
UniProt ID
CADH1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1O6S; 2O72; 2OMT; 2OMU; 2OMV; 2OMX; 2OMY; 2OMZ; 3FF7; 3FF8; 3L6X; 3L6Y; 4ZT1; 4ZTE; 6CXY; 6OLE; 6OLF; 6OLG; 6VEL; 7STZ; 8H62
Pfam ID
PF01049 ; PF00028 ; PF08758
Sequence
MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDC
TGRQRTAYFSLDTRFKVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVG
HHHRPPPHQASVSGIQAELLTFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKS
NKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGN
AVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAI
AYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTAT
AVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDG
GQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDV
NEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTG
AISTRAELDREDFEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTI
FFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEV
GDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQPVEAGLQIPAILGILGGILAL
LILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARP
EVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGS
EAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD
Function
Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. CDH1 is involved in mechanisms regulating cell-cell adhesions, mobility and proliferation of epithelial cells. Has a potent invasive suppressor role. It is a ligand for integrin alpha-E/beta-7; E-Cad/CTF2 promotes non-amyloidogenic degradation of Abeta precursors. Has a strong inhibitory effect on APP C99 and C83 production; (Microbial infection) Serves as a receptor for Listeria monocytogenes; internalin A (InlA) binds to this protein and promotes uptake of the bacteria.
Tissue Specificity Non-neural epithelial tissues.
KEGG Pathway
Rap1 sig.ling pathway (hsa04015 )
Apelin sig.ling pathway (hsa04371 )
Hippo sig.ling pathway (hsa04390 )
Cell adhesion molecules (hsa04514 )
Adherens junction (hsa04520 )
Bacterial invasion of epithelial cells (hsa05100 )
Pathways in cancer (hsa05200 )
Endometrial cancer (hsa05213 )
Thyroid cancer (hsa05216 )
Melanoma (hsa05218 )
Bladder cancer (hsa05219 )
Gastric cancer (hsa05226 )
Reactome Pathway
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933 )
Integrin cell surface interactions (R-HSA-216083 )
Apoptotic cleavage of cell adhesion proteins (R-HSA-351906 )
Adherens junctions interactions (R-HSA-418990 )
RHO GTPases activate IQGAPs (R-HSA-5626467 )
InlA-mediated entry of Listeria monocytogenes into host cells (R-HSA-8876493 )
Formation of definitive endoderm (R-HSA-9823730 )
Degradation of the extracellular matrix (R-HSA-1474228 )

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Blepharocheilodontic syndrome 1 DISMNDOY Definitive Autosomal dominant [1]
CDH1-related diffuse gastric and lobular breast cancer syndrome DISEQ6Z0 Definitive Autosomal dominant [2]
Hereditary breast carcinoma DISAEZT5 Definitive Autosomal dominant [3]
Hereditary diffuse gastric adenocarcinoma DISUIBYS Definitive Autosomal dominant [3]
Cleft soft palate DISCN11I Moderate Autosomal dominant [3]
Blepharocheilodontic syndrome DIS3K312 Supportive Autosomal dominant [4]
Familial ovarian cancer DISGLR2C No Known Autosomal dominant [2]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 2 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Methotrexate DM2TEOL Approved Cadherin-1 (CDH1) increases the response to substance of Methotrexate. [95]
Topotecan DMP6G8T Approved Cadherin-1 (CDH1) affects the response to substance of Topotecan. [96]
------------------------------------------------------------------------------------
93 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Cadherin-1 (CDH1). [5]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Cadherin-1 (CDH1). [6]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Cadherin-1 (CDH1). [7]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Cadherin-1 (CDH1). [8]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Cadherin-1 (CDH1). [9]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Cadherin-1 (CDH1). [10]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Cadherin-1 (CDH1). [6]
Ivermectin DMDBX5F Approved Ivermectin increases the expression of Cadherin-1 (CDH1). [11]
Arsenic DMTL2Y1 Approved Arsenic decreases the expression of Cadherin-1 (CDH1). [12]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Cadherin-1 (CDH1). [13]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Cadherin-1 (CDH1). [14]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide decreases the expression of Cadherin-1 (CDH1). [15]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Cadherin-1 (CDH1). [16]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Cadherin-1 (CDH1). [17]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Cadherin-1 (CDH1). [18]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Cadherin-1 (CDH1). [19]
Decitabine DMQL8XJ Approved Decitabine increases the expression of Cadherin-1 (CDH1). [20]
Marinol DM70IK5 Approved Marinol increases the expression of Cadherin-1 (CDH1). [21]
Menadione DMSJDTY Approved Menadione increases the expression of Cadherin-1 (CDH1). [22]
Fluorouracil DMUM7HZ Approved Fluorouracil decreases the expression of Cadherin-1 (CDH1). [23]
Panobinostat DM58WKG Approved Panobinostat increases the expression of Cadherin-1 (CDH1). [24]
Folic acid DMEMBJC Approved Folic acid increases the expression of Cadherin-1 (CDH1). [25]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of Cadherin-1 (CDH1). [26]
Niclosamide DMJAGXQ Approved Niclosamide increases the expression of Cadherin-1 (CDH1). [27]
Troglitazone DM3VFPD Approved Troglitazone increases the expression of Cadherin-1 (CDH1). [28]
Rosiglitazone DMILWZR Approved Rosiglitazone increases the expression of Cadherin-1 (CDH1). [29]
Ethanol DMDRQZU Approved Ethanol decreases the expression of Cadherin-1 (CDH1). [30]
Diclofenac DMPIHLS Approved Diclofenac increases the expression of Cadherin-1 (CDH1). [32]
Nicotine DMWX5CO Approved Nicotine decreases the expression of Cadherin-1 (CDH1). [33]
Indomethacin DMSC4A7 Approved Indomethacin increases the expression of Cadherin-1 (CDH1). [34]
Menthol DMG2KW7 Approved Menthol increases the expression of Cadherin-1 (CDH1). [35]
Azacitidine DMTA5OE Approved Azacitidine increases the expression of Cadherin-1 (CDH1). [36]
Cocaine DMSOX7I Approved Cocaine decreases the expression of Cadherin-1 (CDH1). [37]
Gemcitabine DMSE3I7 Approved Gemcitabine increases the expression of Cadherin-1 (CDH1). [38]
Mifepristone DMGZQEF Approved Mifepristone increases the expression of Cadherin-1 (CDH1). [39]
Capsaicin DMGMF6V Approved Capsaicin increases the expression of Cadherin-1 (CDH1). [40]
Alitretinoin DMME8LH Approved Alitretinoin affects the expression of Cadherin-1 (CDH1). [41]
Acocantherin DM7JT24 Approved Acocantherin increases the expression of Cadherin-1 (CDH1). [43]
Thalidomide DM70BU5 Approved Thalidomide increases the expression of Cadherin-1 (CDH1). [44]
Colchicine DM2POTE Approved Colchicine affects the activity of Cadherin-1 (CDH1). [46]
Sorafenib DMS8IFC Approved Sorafenib increases the expression of Cadherin-1 (CDH1). [47]
Beta-carotene DM0RXBT Approved Beta-carotene increases the expression of Cadherin-1 (CDH1). [41]
Dinoprostone DMTYOPD Approved Dinoprostone decreases the expression of Cadherin-1 (CDH1). [48]
Nitric Oxide DM1RBYG Approved Nitric Oxide decreases the expression of Cadherin-1 (CDH1). [49]
Vitamin A DMJ2AH4 Approved Vitamin A affects the expression of Cadherin-1 (CDH1). [41]
Sevoflurane DMC9O43 Approved Sevoflurane decreases the expression of Cadherin-1 (CDH1). [50]
Warfarin DMJYCVW Approved Warfarin increases the expression of Cadherin-1 (CDH1). [51]
Ximelegatran DMU8ANS Approved Ximelegatran decreases the activity of Cadherin-1 (CDH1). [52]
Tacrolimus DMZ7XNQ Approved Tacrolimus decreases the expression of Cadherin-1 (CDH1). [53]
Cantharidin DMBP5N3 Approved Cantharidin increases the expression of Cadherin-1 (CDH1). [54]
Masoprocol DMMVNZ0 Approved Masoprocol increases the expression of Cadherin-1 (CDH1). [55]
Ketamine DMT5HA4 Approved Ketamine decreases the expression of Cadherin-1 (CDH1). [56]
Aldosterone DM9S2JW Approved Aldosterone decreases the expression of Cadherin-1 (CDH1). [57]
Polyethylene glycol DM4I1JP Approved Polyethylene glycol increases the expression of Cadherin-1 (CDH1). [58]
Liraglutide DM3FXPS Approved Liraglutide increases the expression of Cadherin-1 (CDH1). [60]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Cadherin-1 (CDH1). [61]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Cadherin-1 (CDH1). [24]
Resveratrol DM3RWXL Phase 3 Resveratrol increases the expression of Cadherin-1 (CDH1). [62]
Epigallocatechin gallate DMCGWBJ Phase 3 Epigallocatechin gallate increases the expression of Cadherin-1 (CDH1). [63]
Curcumin DMQPH29 Phase 3 Curcumin increases the expression of Cadherin-1 (CDH1). [64]
HMPL-004 DM29XGY Phase 3 HMPL-004 increases the expression of Cadherin-1 (CDH1). [65]
Guaiacol DMN4E7T Phase 3 Guaiacol increases the expression of Cadherin-1 (CDH1). [62]
Glycyrrhizin DM8M2N3 Phase 3 Glycyrrhizin increases the expression of Cadherin-1 (CDH1). [66]
Genistein DM0JETC Phase 2/3 Genistein increases the expression of Cadherin-1 (CDH1). [67]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone increases the expression of Cadherin-1 (CDH1). [68]
Thymoquinone DMVDTR2 Phase 2/3 Thymoquinone increases the expression of Cadherin-1 (CDH1). [69]
Belinostat DM6OC53 Phase 2 Belinostat increases the expression of Cadherin-1 (CDH1). [24]
Afimoxifene DMFORDT Phase 2 Afimoxifene increases the expression of Cadherin-1 (CDH1). [70]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate decreases the expression of Cadherin-1 (CDH1). [71]
Puerarin DMJIMXH Phase 2 Puerarin increases the expression of Cadherin-1 (CDH1). [62]
Delphinidin DMS2WIN Phase 2 Delphinidin increases the expression of Cadherin-1 (CDH1). [72]
Netoglitazone DM8H7OA Phase 2 Netoglitazone increases the expression of Cadherin-1 (CDH1). [73]
LY294002 DMY1AFS Phase 1 LY294002 increases the expression of Cadherin-1 (CDH1). [75]
AMEP DMFELMQ Phase 1 AMEP increases the expression of Cadherin-1 (CDH1). [76]
Tetrandrine DMAOJBX Phase 1 Tetrandrine decreases the expression of Cadherin-1 (CDH1). [77]
Arecoline DMFJZK3 Phase 1 Arecoline decreases the expression of Cadherin-1 (CDH1). [78]
TAK-114 DMTXE19 Phase 1 TAK-114 increases the expression of Cadherin-1 (CDH1). [79]
PMID26394986-Compound-22 DM43Z1G Patented PMID26394986-Compound-22 increases the expression of Cadherin-1 (CDH1). [81]
Flavonoid derivative 1 DMCQP0B Patented Flavonoid derivative 1 increases the expression of Cadherin-1 (CDH1). [82]
PMID26394986-Compound-10 DMP8RQ4 Patented PMID26394986-Compound-10 affects the expression of Cadherin-1 (CDH1). [83]
Geldanamycin DMS7TC5 Discontinued in Phase 2 Geldanamycin increases the expression of Cadherin-1 (CDH1). [84]
PJ34 DMXO6YH Preclinical PJ34 increases the expression of Cadherin-1 (CDH1). [85]
Selamectin DM5LU3N Preclinical Selamectin increases the expression of Cadherin-1 (CDH1). [11]
Wortmannin DM8EVK5 Terminated Wortmannin increases the expression of Cadherin-1 (CDH1). [86]
Calphostin C DM9X2D0 Terminated Calphostin C affects the expression of Cadherin-1 (CDH1). [87]
Acteoside DM0YHKB Terminated Acteoside increases the expression of Cadherin-1 (CDH1). [66]
EMBELIN DMFZO4Y Terminated EMBELIN increases the expression of Cadherin-1 (CDH1). [88]
Pifithrin-alpha DM63OD7 Terminated Pifithrin-alpha decreases the expression of Cadherin-1 (CDH1). [89]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Cadherin-1 (CDH1). [90]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Cadherin-1 (CDH1). [91]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Cadherin-1 (CDH1). [26]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Cadherin-1 (CDH1). [92]
Coumarin DM0N8ZM Investigative Coumarin increases the expression of Cadherin-1 (CDH1). [93]
------------------------------------------------------------------------------------
⏷ Show the Full List of 93 Drug(s)
5 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Aspirin DM672AH Approved Aspirin affects the methylation of Cadherin-1 (CDH1). [31]
Hydroxyflutamide DMGIZF5 Approved Hydroxyflutamide increases the phosphorylation of Cadherin-1 (CDH1). [59]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Cadherin-1 (CDH1). [74]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 affects the phosphorylation of Cadherin-1 (CDH1). [80]
Sulforaphane DMQY3L0 Investigative Sulforaphane increases the methylation of Cadherin-1 (CDH1). [94]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Palbociclib DMD7L94 Approved Palbociclib affects the localization of Cadherin-1 (CDH1). [42]
Bicalutamide DMZMSPF Approved Bicalutamide affects the localization of Cadherin-1 (CDH1). [45]
------------------------------------------------------------------------------------

References

1 Whole exome sequencing of distant relatives in multiplex families implicates rare variants in candidate genes for oral clefts. Genetics. 2014 Jul;197(3):1039-44. doi: 10.1534/genetics.114.165225. Epub 2014 May 2.
2 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
3 Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
4 Blepharocheilodontic syndrome is a CDH1 pathway-related disorder due to mutations in CDH1 and CTNND1. Genet Med. 2017 Sep;19(9):1013-1021. doi: 10.1038/gim.2017.11. Epub 2017 Mar 16.
5 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
6 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
7 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
8 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
9 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
10 Cisplatin treatment of primary and metastatic epithelial ovarian carcinomas generates residual cells with mesenchymal stem cell-like profile. J Cell Biochem. 2011 Oct;112(10):2850-64. doi: 10.1002/jcb.23199.
11 Selective Inhibition of SIN3 Corepressor with Avermectins as a Novel Therapeutic Strategy in Triple-Negative Breast Cancer. Mol Cancer Ther. 2015 Aug;14(8):1824-36. doi: 10.1158/1535-7163.MCT-14-0980-T. Epub 2015 Jun 15.
12 Inorganic arsenic promotes luminal to basal transition and metastasis of breast cancer. FASEB J. 2020 Dec;34(12):16034-16048. doi: 10.1096/fj.202001192R. Epub 2020 Oct 13.
13 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
14 Autocrine human growth hormone increases sensitivity of mammary carcinoma cell to arsenic trioxide-induced apoptosis. Mol Cell Endocrinol. 2013 Sep 5;377(1-2):84-92. doi: 10.1016/j.mce.2013.07.002. Epub 2013 Jul 10.
15 Manganese superoxide dismutase induces migration and invasion of tongue squamous cell carcinoma via H2O2-dependent Snail signaling. Free Radic Biol Med. 2012 Jul 1;53(1):44-50. doi: 10.1016/j.freeradbiomed.2012.04.031. Epub 2012 May 9.
16 Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
17 Histone deacetylase inhibitor, suberoylanilide hydroxamic acid (Vorinostat, SAHA) profoundly inhibits the growth of human pancreatic cancer cells. Int J Cancer. 2007 Aug 1;121(3):656-65. doi: 10.1002/ijc.22558.
18 Long-term exposure to triclosan increases migration and invasion of human breast epithelial cells in vitro. J Appl Toxicol. 2021 Jul;41(7):1115-1126. doi: 10.1002/jat.4097. Epub 2020 Nov 10.
19 Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
20 Arsenic trioxide inhibits DNA methyltransferase and restores methylation-silenced genes in human liver cancer cells. Hum Pathol. 2006 Mar;37(3):298-311.
21 ?9-tetrahydrocannabinol inhibits epithelial-mesenchymal transition and metastasis by targeting matrix metalloproteinase-9 in endometrial cancer. Oncol Lett. 2018 Jun;15(6):8527-8535. doi: 10.3892/ol.2018.8407. Epub 2018 Apr 2.
22 Vitamin K3 (menadione) suppresses epithelial-mesenchymal-transition and Wnt signaling pathway in human colorectal cancer cells. Chem Biol Interact. 2019 Aug 25;309:108725. doi: 10.1016/j.cbi.2019.108725. Epub 2019 Jun 22.
23 Dissecting progressive stages of 5-fluorouracil resistance in vitro using RNA expression profiling. Int J Cancer. 2004 Nov 1;112(2):200-12. doi: 10.1002/ijc.20401.
24 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
25 Folic acid modulates cancer-associated micro RNAs and inflammatory mediators in neoplastic and non-neoplastic colonic cells in a different way. Mol Nutr Food Res. 2017 Dec;61(12). doi: 10.1002/mnfr.201700260. Epub 2017 Nov 9.
26 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
27 The Antihelminthic Niclosamide Inhibits Cancer Stemness, Extracellular Matrix Remodeling, and Metastasis through Dysregulation of the Nuclear -catenin/c-Myc axis in OSCC. Sci Rep. 2018 Aug 24;8(1):12776. doi: 10.1038/s41598-018-30692-3.
28 Troglitazone increases expression of E-cadherin and claudin 4 in human pancreatic cancer cells. Biochem Biophys Res Commun. 2009 Mar 13;380(3):614-9. doi: 10.1016/j.bbrc.2009.01.134. Epub 2009 Jan 27.
29 Regulatory role of KEAP1 and NRF2 in PPAR expression and chemoresistance in human non-small-cell lung carcinoma cells. Free Radic Biol Med. 2012 Aug 15;53(4):758-68. doi: 10.1016/j.freeradbiomed.2012.05.041. Epub 2012 Jun 7.
30 Chronic ethanol exposure increases goosecoid (GSC) expression in human embryonic carcinoma cell differentiation. J Appl Toxicol. 2014 Jan;34(1):66-75.
31 Chronic aspirin use suppresses CDH1 methylation in human gastric mucosa. Dig Dis Sci. 2010 Jan;55(1):54-9. doi: 10.1007/s10620-008-0701-4. Epub 2009 Jan 29.
32 Dithiolethione modified valproate and diclofenac increase E-cadherin expression and decrease proliferation of non-small cell lung cancer cells. Lung Cancer. 2010 May;68(2):154-60. doi: 10.1016/j.lungcan.2009.06.012. Epub 2009 Jul 23.
33 Activation of 5-lipoxygenase is required for nicotine mediated epithelial-mesenchymal transition and tumor cell growth. Cancer Lett. 2010 Jun 28;292(2):237-45.
34 Effect of indomethacin on E-cadherin and beta-catenin expression in HT-29 colon cancer cells. Exp Mol Pathol. 2006 Feb;80(1):91-6. doi: 10.1016/j.yexmp.2005.04.008. Epub 2005 Jun 16.
35 Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
36 Promoter methylation as a common mechanism for inactivating E-cadherin in human salivary gland adenoid cystic carcinoma. Cancer. 2007 Jul 1;110(1):87-95. doi: 10.1002/cncr.22758.
37 Transcriptional profiling in the human prefrontal cortex: evidence for two activational states associated with cocaine abuse. Pharmacogenomics J. 2003;3(1):27-40.
38 Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
39 Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
40 Capsaicin inhibits the migration, invasion and EMT of renal cancer cells by inducing AMPK/mTOR-mediated autophagy. Chem Biol Interact. 2022 Oct 1;366:110043. doi: 10.1016/j.cbi.2022.110043. Epub 2022 Aug 28.
41 Beta-carotene and apocarotenals promote retinoid signaling in BEAS-2B human bronchioepithelial cells. Arch Biochem Biophys. 2006 Nov 1;455(1):48-60.
42 Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
43 Ouabain impairs cell migration, and invasion and alters gene expression of human osteosarcoma U-2 OS cells. Environ Toxicol. 2017 Nov;32(11):2400-2413. doi: 10.1002/tox.22453. Epub 2017 Aug 10.
44 Thalidomide suppresses angiogenesis and immune evasion via lncRNA FGD5-AS1/miR-454-3p/ZEB1 axis-mediated VEGFA expression and PD-1/PD-L1 checkpoint in NSCLC. Chem Biol Interact. 2021 Nov 1;349:109652. doi: 10.1016/j.cbi.2021.109652. Epub 2021 Sep 11.
45 Labeling and identification of LNCaP cell surface proteins: a pilot study. Prostate. 2007 Jun 15;67(9):943-54. doi: 10.1002/pros.20580.
46 Induced differentiation in HT29, a human colon adenocarcinoma cell line. J Cell Sci. 1999 Aug;112 ( Pt 16):2657-66. doi: 10.1242/jcs.112.16.2657.
47 Destruxin B inhibits hepatocellular carcinoma cell growth through modulation of the Wnt/-catenin signaling pathway and epithelial-mesenchymal transition. Toxicol In Vitro. 2014 Jun;28(4):552-61. doi: 10.1016/j.tiv.2014.01.002. Epub 2014 Jan 13.
48 Cryptotanshinone (Dsh-003) from Salvia miltiorrhiza Bunge inhibits prostaglandin E2-induced survival and invasion effects in HA22T hepatocellular carcinoma cells. Environ Toxicol. 2018 Dec;33(12):1254-1260. doi: 10.1002/tox.22633. Epub 2018 Sep 12.
49 Nitric oxide causes anoikis through attenuation of E-cadherin and activation of caspase-3 in human gastric carcinoma AZ-521 cells infected with Mycoplasma hyorhinis. J Vet Med Sci. 2010 Jul;72(7):869-74.
50 The differential cancer growth associated with anaesthetics in a cancer xenograft model of mice: mechanisms and implications of postoperative cancer recurrence. Cell Biol Toxicol. 2023 Aug;39(4):1561-1575. doi: 10.1007/s10565-022-09747-9. Epub 2022 Aug 12.
51 Warfarin Blocks Gas6-Mediated Axl Activation Required for Pancreatic Cancer Epithelial Plasticity and Metastasis. Cancer Res. 2015 Sep 15;75(18):3699-705. doi: 10.1158/0008-5472.CAN-14-2887-T. Epub 2015 Jul 23.
52 Myosin 2 is a key Rho kinase target necessary for the local concentration of E-cadherin at cell-cell contacts. Mol Biol Cell. 2005 Oct;16(10):4531-42.
53 GSK3, snail, and adhesion molecule regulation by cyclosporine A in renal tubular cells. Toxicol Sci. 2012 Jun;127(2):425-37. doi: 10.1093/toxsci/kfs108. Epub 2012 Mar 12.
54 Cantharidin suppresses gastric cancer cell migration/invasion by inhibiting the PI3K/Akt signaling pathway via CCAT1. Chem Biol Interact. 2020 Feb 1;317:108939. doi: 10.1016/j.cbi.2020.108939. Epub 2020 Jan 13.
55 Nordihydroguaiaretic acid restores expression of silenced E-cadherin gene in human breast cancer cell lines and xenografts. Anticancer Drugs. 2008 Jun;19(5):487-94. doi: 10.1097/CAD.0b013e3282fd5310.
56 Ketamine-induced bladder fibrosis involves epithelial-to-mesenchymal transition mediated by transforming growth factor-1. Am J Physiol Renal Physiol. 2017 Oct 1;313(4):F961-F972. doi: 10.1152/ajprenal.00686.2016. Epub 2017 Mar 22.
57 Aldosterone induces epithelial-mesenchymal transition via ROS of mitochondrial origin. Am J Physiol Renal Physiol. 2007 Sep;293(3):F723-31. doi: 10.1152/ajprenal.00480.2006. Epub 2007 Jun 27.
58 Regulation of epithelial cell morphology and functions approaching to more in vivo-like by modifying polyethylene glycol on polysulfone membranes. PLoS One. 2012;7(4):e36110.
59 Anti-androgen 2-hydroxyflutamide modulates cadherin, catenin and androgen receptor phosphorylation in androgen-sensitive LNCaP and androgen-independent PC3 prostate cancer cell lines acting via PI3K/Akt and MAPK/ERK1/2 pathways. Toxicol In Vitro. 2017 Apr;40:324-335. doi: 10.1016/j.tiv.2017.01.019. Epub 2017 Feb 2.
60 Antitumoral activity of liraglutide, a new DNMT inhibitor in breast cancer cells in vitro and in vivo. Chem Biol Interact. 2021 Nov 1;349:109641. doi: 10.1016/j.cbi.2021.109641. Epub 2021 Sep 14.
61 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
62 Examining the genomic influence of skin antioxidants in vitro. Mediators Inflamm. 2010;2010.
63 Mechanisms of DNA methyltransferase-inhibitor interactions: Procyanidin B2 shows new promise for therapeutic intervention of cancer. Chem Biol Interact. 2015 May 25;233:122-38. doi: 10.1016/j.cbi.2015.03.022. Epub 2015 Mar 31.
64 Potent growth suppressive activity of curcumin in human breast cancer cells: Modulation of Wnt/beta-catenin signaling. Chem Biol Interact. 2009 Oct 7;181(2):263-71. doi: 10.1016/j.cbi.2009.06.012. Epub 2009 Jun 30.
65 Andrographolide inhibits the growth of human osteosarcoma cells by suppressing Wnt/-catenin, PI3K/AKT and NF-B signaling pathways. Chem Biol Interact. 2022 Sep 25;365:110068. doi: 10.1016/j.cbi.2022.110068. Epub 2022 Jul 31.
66 Verbascoside inhibits the epithelial-mesenchymal transition of prostate cancer cells through high-mobility group box 1/receptor for advanced glycation end-products/TGF- pathway. Environ Toxicol. 2021 Jun;36(6):1080-1089. doi: 10.1002/tox.23107. Epub 2021 Feb 1.
67 The Effects of Combinatorial Genistein and Sulforaphane in Breast Tumor Inhibition: Role in Epigenetic Regulation. Int J Mol Sci. 2018 Jun 13;19(6):1754. doi: 10.3390/ijms19061754.
68 Cancer metastasis and EGFR signaling is suppressed by amiodarone-induced versican V2. Oncotarget. 2015 Dec 15;6(40):42976-87. doi: 10.18632/oncotarget.5621.
69 Thymoquinone suppresses invasion and metastasis in bladder cancer cells by reversing EMT through the Wnt/-catenin signaling pathway. Chem Biol Interact. 2020 Apr 1;320:109022. doi: 10.1016/j.cbi.2020.109022. Epub 2020 Feb 27.
70 E-cadherin mediates the aggregation of breast cancer cells induced by tamoxifen and epidermal growth factor. Breast Cancer Res Treat. 2010 May;121(1):79-89. doi: 10.1007/s10549-009-0456-4. Epub 2009 Jul 11.
71 Antroquinonol from Antrodia Camphorata suppresses breast tumor migration/invasion through inhibiting ERK-AP-1- and AKT-NF-B-dependent MMP-9 and epithelial-mesenchymal transition expressions. Food Chem Toxicol. 2015 Apr;78:33-41. doi: 10.1016/j.fct.2015.01.012. Epub 2015 Feb 2.
72 Delphinidin induces apoptosis and inhibits epithelial-to-mesenchymal transition via the ERK/p38 MAPK-signaling pathway in human osteosarcoma cell lines. Environ Toxicol. 2018 Jun;33(6):640-649. doi: 10.1002/tox.22548. Epub 2018 Feb 16.
73 RWJ-241947 (MCC-555), a unique peroxisome proliferator-activated receptor-gamma ligand with antitumor activity against human prostate cancer in vitro and in beige/nude/ X-linked immunodeficient mice and enhancement of apoptosis in myeloma cells induced by arsenic trioxide. Clin Cancer Res. 2004 Feb 15;10(4):1508-20. doi: 10.1158/1078-0432.ccr-0476-03.
74 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
75 3,5,4'-Trimethoxystilbene, a natural methoxylated analog of resveratrol, inhibits breast cancer cell invasiveness by downregulation of PI3K/Akt and Wnt/-catenin signaling cascades and reversal of epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2013 Nov 1;272(3):746-56. doi: 10.1016/j.taap.2013.07.019. Epub 2013 Aug 3.
76 Glyphosate and Aminomethylphosphonic Acid (AMPA) Modulate Glutathione S-Transferase in Non-Tumorigenic Prostate Cells. Int J Mol Sci. 2023 Mar 28;24(7):6323. doi: 10.3390/ijms24076323.
77 Tetrandrine inhibits human brain glioblastoma multiforme GBM 8401 cancer cell migration and invasion in vitro. Environ Toxicol. 2019 Apr;34(4):364-374. doi: 10.1002/tox.22691. Epub 2018 Dec 13.
78 Arecoline induces epithelial mesenchymal transition in HK2 cells by upregulating the ERK-mediated signaling pathway. Environ Toxicol. 2020 Sep;35(9):1007-1014. doi: 10.1002/tox.22937. Epub 2020 May 22.
79 Methylisoindigo preferentially kills cancer stem cells by interfering cell metabolism via inhibition of LKB1 and activation of AMPK in PDACs. Mol Oncol. 2016 Jun;10(6):806-24. doi: 10.1016/j.molonc.2016.01.008. Epub 2016 Feb 4.
80 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
81 COX-2 inhibition by celecoxib in epithelial ovarian cancer attenuates E-cadherin suppression through reduced Snail nuclear translocation. Chem Biol Interact. 2018 Aug 25;292:24-29. doi: 10.1016/j.cbi.2018.06.020. Epub 2018 Jun 20.
82 Luteolin exerts pro-apoptotic effect and anti-migration effects on A549 lung adenocarcinoma cells through the activation of MEK/ERK signaling pathway. Chem Biol Interact. 2016 Sep 25;257:26-34. doi: 10.1016/j.cbi.2016.07.028. Epub 2016 Jul 26.
83 Antitumor progression potential of morusin suppressing STAT3 and NFB in human hepatoma SK-Hep1 cells. Toxicol Lett. 2015 Jan 22;232(2):490-8. doi: 10.1016/j.toxlet.2014.11.031. Epub 2014 Dec 2.
84 Enhancement of adenoviral MDA-7-mediated cell killing in human lung cancer cells by geldanamycin and its 17-allyl- amino-17-demethoxy analogue. Cancer Gene Ther. 2007 Jan;14(1):12-8. doi: 10.1038/sj.cgt.7700989. Epub 2006 Oct 6.
85 Effects of PARP-1 inhibitor and ERK inhibitor on epithelial mesenchymal transitions of the ovarian cancer SKOV3 cells. Pharmacol Rep. 2016 Dec;68(6):1225-1229. doi: 10.1016/j.pharep.2016.08.001. Epub 2016 Aug 2.
86 (-)-Liriopein B Suppresses Breast Cancer Progression via Inhibition of Multiple Kinases. Chem Res Toxicol. 2015 May 18;28(5):897-906. doi: 10.1021/tx500518j. Epub 2015 Apr 21.
87 Targeting the beta-catenin/TCF transcriptional complex in the treatment of multiple myeloma. Proc Natl Acad Sci U S A. 2007 May 1;104(18):7516-21. doi: 10.1073/pnas.0610299104. Epub 2007 Apr 23.
88 Embelin suppresses growth of human pancreatic cancer xenografts, and pancreatic cancer cells isolated from KrasG12D mice by inhibiting Akt and Sonic hedgehog pathways. PLoS One. 2014 Apr 2;9(4):e92161.
89 The vicious cycle between ferritinophagy and ROS production triggered EMT inhibition of gastric cancer cells was through p53/AKT/mTor pathway. Chem Biol Interact. 2020 Sep 1;328:109196. doi: 10.1016/j.cbi.2020.109196. Epub 2020 Jul 18.
90 Bisphenolic compounds alter gene expression in MCF-7 cells through interaction with estrogen receptor . Toxicol Appl Pharmacol. 2020 Jul 15;399:115030. doi: 10.1016/j.taap.2020.115030. Epub 2020 May 6.
91 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
92 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
93 A synthetic coumarin derivative (4-flourophenylacetamide-acetyl coumarin) impedes cell cycle at G0/G1 stage, induces apoptosis, and inhibits metastasis via ROS-mediated p53 and AKT signaling pathways in A549 cells. J Biochem Mol Toxicol. 2020 Oct;34(10):e22553. doi: 10.1002/jbt.22553. Epub 2020 Jun 24.
94 Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
95 Role of caveolin 1, E-cadherin, Enolase 2 and PKCalpha on resistance to methotrexate in human HT29 colon cancer cells. BMC Med Genomics. 2008 Aug 11;1:35. doi: 10.1186/1755-8794-1-35.
96 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.