Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFSC9MR)

• DOT Name: RNA-binding motif, single-stranded-interacting protein 3 (RBMS3)
• Gene Name: RBMS3
• Related Disease:
  Esophageal squamous cell carcinoma
  Melanoma
  Narcolepsy
  Acute myelogenous leukaemia
  Adult glioblastoma
  Advanced cancer
  Alzheimer disease
  Amyotrophic lateral sclerosis
  Arteriosclerosis
  Atherosclerosis
  Carcinoma
  Carcinoma of liver and intrahepatic biliary tract
  Cervical cancer
  Cervical carcinoma
  Chronic obstructive pulmonary disease
  Clear cell renal carcinoma
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Congestive heart failure
  Epithelial ovarian cancer
  Frontotemporal dementia
  Glioblastoma multiforme
  Glioma
  Head-neck squamous cell carcinoma
  Hepatocellular carcinoma
  Liver cancer
  Lung cancer
  Lung carcinoma
  Lung neoplasm
  Nasopharyngeal carcinoma
  Neoplasm
  Nervous system inflammation
  Non-small-cell lung cancer
  Ovarian cancer
  Ovarian neoplasm
  Prostate cancer
  Prostate carcinoma
  Renal cell carcinoma
  Squamous cell carcinoma
  Bipolar disorder
  Gastric cancer
  Stomach cancer
  Teratoma
  Breast cancer
  Breast carcinoma
  Fragile X syndrome
  Pancreatic cancer
  Parkinson disease
• UniProt ID: RBMS3_HUMAN
• Pfam ID: PF00076
• Sequence:
  MGKRLDQPQMYPQYTYYYPHYLQTKQSYAPAPHPMAPPSPSTNSSSNNSSNNSSGEQLSK
  TNLYIRGLPPGTTDQDLIKLCQPYGKIVSTKAILDKNTNQCKGYGFVDFDSPAAAQKAVA
  SLKANGVQAQMAKQQEQDPTNLYISNLPISMDEQELENMLKPFGHVISTRILRDANGVSR
  GVGFARMESTEKCEVVIQHFNGKYLKTPPGIPAPSEPLLCKFADGGQKKRQNQSKYTQNG
  RPWPREGEAGMALTYDPTAAIQNGFYSSPYSIATNRMIPQTSITPFIAASPVSTYQVQST
  SWMPHPPYVMQPTGAVITPTMDHPMSMQPANMMGPLTQQMNHLSLGTTGTIQSQDRIMIL
  HQLLCQYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAV
  DTSNEHAPAYSYQQSKP
• Function: Binds poly(A) and poly(U) oligoribonucleotides.
• Tissue Specificity: Expressed in fetal brain, fetal lung, fetal liver, heart, brain, placenta, lung, liver, muscle, kidney and pancreas.

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Esophageal squamous cell carcinoma	DIS5N2GV	Definitive	Biomarker	[1]
Melanoma	DIS1RRCY	Definitive	Biomarker	[2]
Narcolepsy	DISLCNLI	Definitive	Genetic Variation	[3]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[4]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[5]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[6]
Alzheimer disease	DISF8S70	Strong	Biomarker	[7]
Amyotrophic lateral sclerosis	DISF7HVM	Strong	Genetic Variation	[8]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[9]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[9]
Carcinoma	DISH9F1N	Strong	Genetic Variation	[10]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Strong	Altered Expression	[11]
Cervical cancer	DISFSHPF	Strong	Biomarker	[12]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[12]
Chronic obstructive pulmonary disease	DISQCIRF	Strong	Genetic Variation	[13]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[14]
Colon cancer	DISVC52G	Strong	Biomarker	[15]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[15]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[16]
Congestive heart failure	DIS32MEA	Strong	Genetic Variation	[17]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[18]
Frontotemporal dementia	DISKYHXL	Strong	Biomarker	[19]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[5]
Glioma	DIS5RPEH	Strong	Biomarker	[20]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[21]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[22]
Liver cancer	DISDE4BI	Strong	Altered Expression	[23]
Lung cancer	DISCM4YA	Strong	Biomarker	[24]
Lung carcinoma	DISTR26C	Strong	Biomarker	[24]
Lung neoplasm	DISVARNB	Strong	Altered Expression	[25]
Nasopharyngeal carcinoma	DISAOTQ0	Strong	Biomarker	[1]
Neoplasm	DISZKGEW	Strong	Biomarker	[26]
Nervous system inflammation	DISB3X5A	Strong	Biomarker	[27]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[28]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[29]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[29]
Prostate cancer	DISF190Y	Strong	Biomarker	[30]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[30]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[14]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[31]
Bipolar disorder	DISAM7J2	moderate	Genetic Variation	[32]
Gastric cancer	DISXGOUK	moderate	Biomarker	[33]
Stomach cancer	DISKIJSX	moderate	Biomarker	[33]
Teratoma	DIS6ICY4	moderate	Altered Expression	[34]
Breast cancer	DIS7DPX1	Limited	Altered Expression	[26]
Breast carcinoma	DIS2UE88	Limited	Altered Expression	[26]
Fragile X syndrome	DISE8W3A	Limited	Altered Expression	[35]
Pancreatic cancer	DISJC981	Limited	Biomarker	[36]
Parkinson disease	DISQVHKL	Limited	Biomarker	[37]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of RNA-binding motif, single-stranded-interacting protein 3 (RBMS3).	[38]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of RNA-binding motif, single-stranded-interacting protein 3 (RBMS3).	[50]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of RNA-binding motif, single-stranded-interacting protein 3 (RBMS3).	[39]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of RNA-binding motif, single-stranded-interacting protein 3 (RBMS3).	[40]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of RNA-binding motif, single-stranded-interacting protein 3 (RBMS3).	[41]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of RNA-binding motif, single-stranded-interacting protein 3 (RBMS3).	[42]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of RNA-binding motif, single-stranded-interacting protein 3 (RBMS3).	[43]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of RNA-binding motif, single-stranded-interacting protein 3 (RBMS3).	[44]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of RNA-binding motif, single-stranded-interacting protein 3 (RBMS3).	[45]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of RNA-binding motif, single-stranded-interacting protein 3 (RBMS3).	[46]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the mutagenesis of RNA-binding motif, single-stranded-interacting protein 3 (RBMS3).	[47]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of RNA-binding motif, single-stranded-interacting protein 3 (RBMS3).	[48]
Geldanamycin	DMS7TC5	Discontinued in Phase 2	Geldanamycin increases the expression of RNA-binding motif, single-stranded-interacting protein 3 (RBMS3).	[49]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of RNA-binding motif, single-stranded-interacting protein 3 (RBMS3).	[51]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of RNA-binding motif, single-stranded-interacting protein 3 (RBMS3).	[52]

References

• [1] RBMS3 is a tumor suppressor gene that acts as a favorable prognostic marker in lung squamous cell carcinoma.Med Oncol. 2015 Feb;32(2):459. doi: 10.1007/s12032-014-0459-9. Epub 2015 Jan 15.
• [2] Extracellular vesicle-dependent effect of RNA-binding protein IGF2BP1 on melanoma metastasis.Oncogene. 2019 May;38(21):4182-4196. doi: 10.1038/s41388-019-0797-3. Epub 2019 Apr 1.
• [3] Genome-wide association database developed in the Japanese Integrated Database Project.J Hum Genet. 2009 Sep;54(9):543-6. doi: 10.1038/jhg.2009.68. Epub 2009 Jul 24.
• [4] Targeting an RNA-Binding Protein Network in Acute Myeloid Leukemia.Cancer Cell. 2019 Mar 18;35(3):369-384.e7. doi: 10.1016/j.ccell.2019.01.010. Epub 2019 Feb 21.
• [5] RNA-Binding Protein Musashi1 Is a Central Regulator of Adhesion Pathways in Glioblastoma.Mol Cell Biol. 2015 Sep 1;35(17):2965-78. doi: 10.1128/MCB.00410-15. Epub 2015 Jun 22.
• [6] RNA-Binding Protein HuR Regulates Both Mutant and Wild-Type IDH1 in IDH1-Mutated Cancer.Mol Cancer Res. 2019 Feb;17(2):508-520. doi: 10.1158/1541-7786.MCR-18-0557. Epub 2018 Sep 28.
• [7] Amyloid precursor protein, an androgen-regulated gene, is targeted by RNA-binding protein PSF/SFPQ in neuronal cells.Genes Cells. 2019 Nov;24(11):719-730. doi: 10.1111/gtc.12721. Epub 2019 Oct 15.
• [8] Single-copy expression of an amyotrophic lateral sclerosis-linked TDP-43 mutation (M337V) in BAC transgenic mice leads to altered stress granule dynamics and progressive motor dysfunction.Neurobiol Dis. 2019 Jan;121:148-162. doi: 10.1016/j.nbd.2018.09.024. Epub 2018 Oct 2.
• [9] Endothelial HuR deletion reduces the expression of proatherogenic molecules and attenuates atherosclerosis.Int Immunopharmacol. 2018 Dec;65:248-255. doi: 10.1016/j.intimp.2018.09.023. Epub 2018 Oct 17.
• [10] Role of the RNA-binding protein HuR in colon carcinogenesis.Oncogene. 2003 Oct 16;22(46):7146-54. doi: 10.1038/sj.onc.1206862.
• [11] Aberrant expression of fetal RNA-binding protein p62 in liver cancer and liver cirrhosis.Am J Pathol. 2001 Sep;159(3):945-53. doi: 10.1016/S0002-9440(10)61770-1.
• [12] Msi1 promotes tumor growth and cell proliferation by targeting cell cycle checkpoint proteins p21, p27 and p53 in cervical carcinomas.Oncotarget. 2014 Nov 15;5(21):10870-85. doi: 10.18632/oncotarget.2539.
• [13] Genetic landscape of chronic obstructive pulmonary disease identifies heterogeneous cell-type and phenotype associations.Nat Genet. 2019 Mar;51(3):494-505. doi: 10.1038/s41588-018-0342-2. Epub 2019 Feb 25.
• [14] Role of the RNA-binding protein HuR in human renal cell carcinoma.Carcinogenesis. 2010 Jun;31(6):1018-26. doi: 10.1093/carcin/bgq052. Epub 2010 Mar 10.
• [15] RNA-binding protein quaking, a critical regulator of colon epithelial differentiation and a suppressor of colon cancer.Gastroenterology. 2010 Jan;138(1):231-40.e1-5. doi: 10.1053/j.gastro.2009.08.001. Epub 2009 Aug 15.
• [16] The RNA-Binding Protein HuR Confers Oxaliplatin Resistance of Colorectal Cancer By Upregulating CDC6.Mol Cancer Ther. 2019 Jul;18(7):1243-1254. doi: 10.1158/1535-7163.MCT-18-0945. Epub 2019 May 7.
• [17] RNA-binding protein RBM20 represses splicing to orchestrate cardiac pre-mRNA processing.J Clin Invest. 2014 Aug;124(8):3419-30. doi: 10.1172/JCI74523. Epub 2014 Jun 24.
• [18] Loss of RBMS3 Confers Platinum Resistance in Epithelial Ovarian Cancer via Activation of miR-126-5p/-catenin/CBP signaling.Clin Cancer Res. 2019 Feb 1;25(3):1022-1035. doi: 10.1158/1078-0432.CCR-18-2554. Epub 2018 Oct 2.
• [19] Functional and dynamic polymerization of the ALS-linked protein TDP-43 antagonizes its pathologic aggregation.Nat Commun. 2017 Jun 29;8(1):45. doi: 10.1038/s41467-017-00062-0.
• [20] Hu antigen R (HuR) multimerization contributes to glioma disease progression.J Biol Chem. 2017 Oct 13;292(41):16999-17010. doi: 10.1074/jbc.M117.797878. Epub 2017 Aug 8.
• [21] Characterization of squamous cell carcinoma in an organotypic culture via subsurface non-linear optical molecular imaging.Exp Biol Med (Maywood). 2013 Nov 1;238(11):1233-41. doi: 10.1177/1535370213502628. Epub 2013 Oct 1.
• [22] Lin28b is involved in curcumin-reversed paclitaxel chemoresistance and associated with poor prognosis in hepatocellular carcinoma.J Cancer. 2019 Oct 15;10(24):6074-6087. doi: 10.7150/jca.33421. eCollection 2019.
• [23] RBMY, a male germ cell-specific RNA-binding protein, activated in human liver cancers and transforms rodent fibroblasts.Oncogene. 2004 Jul 29;23(34):5815-22. doi: 10.1038/sj.onc.1207773.
• [24] HnRNP-L promotes prostate cancer progression by enhancing cell cycling and inhibiting apoptosis.Oncotarget. 2017 Mar 21;8(12):19342-19353. doi: 10.18632/oncotarget.14258.
• [25] Expression of the RNA-binding protein CRD-BP in brain and non-small cell lung tumors.Cancer Lett. 2004 Jun 25;209(2):245-50. doi: 10.1016/j.canlet.2003.12.015.
• [26] The RNA binding protein RBMS3 inhibits the metastasis of breast cancer by regulating Twist1 expression.J Exp Clin Cancer Res. 2019 Feb 28;38(1):105. doi: 10.1186/s13046-019-1111-5.
• [27] Dysfunctional RNA-binding protein biology and neurodegeneration in experimental autoimmune encephalomyelitis in female mice.J Neurosci Res. 2020 Apr;98(4):704-717. doi: 10.1002/jnr.24554. Epub 2019 Nov 22.
• [28] The RNA-binding protein HuR stabilizes cytosolic phospholipase A2 mRNA under interleukin-1 treatment in non-small cell lung cancer A549 Cells.J Biol Chem. 2011 Oct 14;286(41):35499-35508. doi: 10.1074/jbc.M111.263582. Epub 2011 Aug 23.
• [29] Identification of clinical trait-related lncRNA and mRNA biomarkers with weighted gene co-expression network analysis as useful tool for personalized medicine in ovarian cancer.EPMA J. 2019 Jul 19;10(3):273-290. doi: 10.1007/s13167-019-00175-0. eCollection 2019 Sep.
• [30] The RNA-binding protein FXR1 modulates prostate cancer progression by regulating FBXO4.Funct Integr Genomics. 2019 May;19(3):487-496. doi: 10.1007/s10142-019-00661-8. Epub 2019 Feb 11.
• [31] Repression of caspase-3 and RNA-binding protein HuR cleavage by cyclooxygenase-2 promotes drug resistance in oral squamous cell carcinoma.Oncogene. 2017 Jun 1;36(22):3137-3148. doi: 10.1038/onc.2016.451. Epub 2016 Dec 12.
• [32] A genome-wide association study of bipolar disorder in Norwegian individuals, followed by replication in Icelandic sample.J Affect Disord. 2010 Oct;126(1-2):312-6. doi: 10.1016/j.jad.2010.04.007. Epub 2010 May 7.
• [33] Down regulation of RNA binding motif, single-stranded interacting protein 3, along with up regulation of nuclear HIF1A correlates with poor prognosis in patients with gastric cancer.Oncotarget. 2017 Jan 3;8(1):1262-1277. doi: 10.18632/oncotarget.13605.
• [34] Mammalian germ cells are determined after PGC colonization of the nascent gonad.Proc Natl Acad Sci U S A. 2019 Dec 17;116(51):25677-25687. doi: 10.1073/pnas.1910733116. Epub 2019 Nov 21.
• [35] Fragile X Syndrome: from molecular pathology to therapy.Neurosci Biobehav Rev. 2014 Oct;46 Pt 2:242-55. doi: 10.1016/j.neubiorev.2014.01.006. Epub 2014 Jan 22.
• [36] Identification of Upregulated HNRNPs Associated with Poor Prognosis in Pancreatic Cancer.Biomed Res Int. 2019 Jul 4;2019:5134050. doi: 10.1155/2019/5134050. eCollection 2019.
• [37] Association between the neuron-specific RNA-binding protein ELAVL4 and Parkinson disease.Hum Genet. 2005 Jun;117(1):27-33. doi: 10.1007/s00439-005-1259-2. Epub 2005 Apr 13.
• [38] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [39] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [40] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [41] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [42] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [43] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [44] Identification of novel low-dose bisphenol a targets in human foreskin fibroblast cells derived from hypospadias patients. PLoS One. 2012;7(5):e36711. doi: 10.1371/journal.pone.0036711. Epub 2012 May 4.
• [45] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [46] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [47] Exome-wide mutation profile in benzo[a]pyrene-derived post-stasis and immortal human mammary epithelial cells. Mutat Res Genet Toxicol Environ Mutagen. 2014 Dec;775-776:48-54. doi: 10.1016/j.mrgentox.2014.10.011. Epub 2014 Nov 4.
• [48] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [49] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [50] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [51] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [52] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.