Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHJ7JV9)

• DOT Name: Ankyrin repeat domain-containing protein 1 (ANKRD1)
• Synonyms: Cardiac ankyrin repeat protein; Cytokine-inducible gene C-193 protein; Cytokine-inducible nuclear protein
• Gene Name: ANKRD1
• Related Disease:
  Lung cancer
  Lung carcinoma
  Arrhythmogenic right ventricular cardiomyopathy
  Astrocytoma
  Breast adenocarcinoma
  Cardiac disease
  Cardiovascular disease
  Cerebellar ataxia
  Diabetic kidney disease
  Dilated cardiomyopathy 1A
  Familial dilated cardiomyopathy
  Glomerulonephritis
  Herpes simplex infection
  Intellectual disability
  Lupus nephritis
  Myositis disease
  Rhabdomyosarcoma
  Stomach cancer
  Triple negative breast cancer
  Amyotrophic lateral sclerosis
  Cardiac failure
  Cardiomyopathy
  Congestive heart failure
  Stroke
  Obsolete familial isolated dilated cardiomyopathy
  Endometriosis
  Hypertrophic cardiomyopathy
  Adenocarcinoma
  Colorectal carcinoma
  Congenital heart disease
  Dilated cardiomyopathy
  Pancreatic cancer
• UniProt ID: ANKR1_HUMAN
• Pfam ID: PF12796
• Sequence:
  MMVLKVEELVTGKKNGNGEAGEFLPEDFRDGEYEAAVTLEKQEDLKTLLAHPVTLGEQQW
  KSEKQREAELKKKKLEQRSKLENLEDLEIIIQLKKRKKYRKTKVPVVKEPEPEIITEPVD
  VPTFLKAALENKLPVVEKFLSDKNNPDVCDEYKRTALHRACLEGHLAIVEKLMEAGAQIE
  FRDMLESTAIHWASRGGNLDVLKLLLNKGAKISARDKLLSTALHVAVRTGHYECAEHLIA
  CEADLNAKDREGDTPLHDAVRLNRYKMIRLLIMYGADLNIKNCAGKTPMDLVLHWQNGTK
  AIFDSLRENSYKTSRIATF
• Function: May play an important role in endothelial cell activation. May act as a nuclear transcription factor that negatively regulates the expression of cardiac genes. Induction seems to be correlated with apoptotic cell death in hepatoma cells.
• Tissue Specificity: Mainly expressed in activated vascular endothelial cells. To a lower extent, also expressed in hepatoma cells.
• KEGG Pathway: Cytoskeleton in muscle cells (hsa04820)
• Reactome Pathway: PPARA activates gene expression (R-HSA-1989781)

Molecular Interaction Atlas (MIA) of This DOT

32 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung cancer	DISCM4YA	Definitive	Genetic Variation	[1]
Lung carcinoma	DISTR26C	Definitive	Genetic Variation	[1]
Arrhythmogenic right ventricular cardiomyopathy	DIS3V2BE	Strong	Biomarker	[2]
Astrocytoma	DISL3V18	Strong	Biomarker	[3]
Breast adenocarcinoma	DISMPHJ0	Strong	Altered Expression	[4]
Cardiac disease	DISVO1I5	Strong	Biomarker	[5]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[6]
Cerebellar ataxia	DIS9IRAV	Strong	Biomarker	[7]
Diabetic kidney disease	DISJMWEY	Strong	Altered Expression	[8]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Genetic Variation	[9]
Familial dilated cardiomyopathy	DISBHDU9	Strong	GermlineCausalMutation	[10]
Glomerulonephritis	DISPZIQ3	Strong	Altered Expression	[8]
Herpes simplex infection	DISL1SAV	Strong	Biomarker	[11]
Intellectual disability	DISMBNXP	Strong	Biomarker	[7]
Lupus nephritis	DISCVGPZ	Strong	Altered Expression	[8]
Myositis disease	DISCIXF0	Strong	Genetic Variation	[12]
Rhabdomyosarcoma	DISNR7MS	Strong	Altered Expression	[13]
Stomach cancer	DISKIJSX	Strong	Genetic Variation	[14]
Triple negative breast cancer	DISAMG6N	Strong	Altered Expression	[15]
Amyotrophic lateral sclerosis	DISF7HVM	moderate	Altered Expression	[16]
Cardiac failure	DISDC067	moderate	Biomarker	[6]
Cardiomyopathy	DISUPZRG	moderate	Genetic Variation	[17]
Congestive heart failure	DIS32MEA	moderate	Biomarker	[6]
Stroke	DISX6UHX	moderate	Biomarker	[18]
Obsolete familial isolated dilated cardiomyopathy	DIS4FXO4	Supportive	Autosomal dominant	[10]
Endometriosis	DISX1AG8	Disputed	Biomarker	[19]
Hypertrophic cardiomyopathy	DISQG2AI	Disputed	Autosomal dominant	[20]
Adenocarcinoma	DIS3IHTY	Limited	Altered Expression	[21]
Colorectal carcinoma	DIS5PYL0	Limited	Posttranslational Modification	[22]
Congenital heart disease	DISQBA23	Limited	Altered Expression	[23]
Dilated cardiomyopathy	DISX608J	Limited	Autosomal dominant	[20]
Pancreatic cancer	DISJC981	Limited	Biomarker	[24]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
DTI-015	DMXZRW0	Approved	Ankyrin repeat domain-containing protein 1 (ANKRD1) affects the response to substance of DTI-015.	[48]

26 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Ankyrin repeat domain-containing protein 1 (ANKRD1).	[25]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Ankyrin repeat domain-containing protein 1 (ANKRD1).	[26]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Ankyrin repeat domain-containing protein 1 (ANKRD1).	[27]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Ankyrin repeat domain-containing protein 1 (ANKRD1).	[28]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Ankyrin repeat domain-containing protein 1 (ANKRD1).	[29]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Ankyrin repeat domain-containing protein 1 (ANKRD1).	[30]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Ankyrin repeat domain-containing protein 1 (ANKRD1).	[31]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Ankyrin repeat domain-containing protein 1 (ANKRD1).	[32]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Ankyrin repeat domain-containing protein 1 (ANKRD1).	[33]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Ankyrin repeat domain-containing protein 1 (ANKRD1).	[34]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Ankyrin repeat domain-containing protein 1 (ANKRD1).	[35]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Ankyrin repeat domain-containing protein 1 (ANKRD1).	[36]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Ankyrin repeat domain-containing protein 1 (ANKRD1).	[34]
Folic acid	DMEMBJC	Approved	Folic acid increases the expression of Ankyrin repeat domain-containing protein 1 (ANKRD1).	[37]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Ankyrin repeat domain-containing protein 1 (ANKRD1).	[38]
Gemcitabine	DMSE3I7	Approved	Gemcitabine increases the expression of Ankyrin repeat domain-containing protein 1 (ANKRD1).	[36]
Ampicillin	DMHWE7P	Approved	Ampicillin increases the expression of Ankyrin repeat domain-containing protein 1 (ANKRD1).	[39]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Ankyrin repeat domain-containing protein 1 (ANKRD1).	[40]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Ankyrin repeat domain-containing protein 1 (ANKRD1).	[31]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Ankyrin repeat domain-containing protein 1 (ANKRD1).	[41]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Ankyrin repeat domain-containing protein 1 (ANKRD1).	[43]
Geldanamycin	DMS7TC5	Discontinued in Phase 2	Geldanamycin increases the expression of Ankyrin repeat domain-containing protein 1 (ANKRD1).	[44]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Ankyrin repeat domain-containing protein 1 (ANKRD1).	[45]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Ankyrin repeat domain-containing protein 1 (ANKRD1).	[46]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Ankyrin repeat domain-containing protein 1 (ANKRD1).	[47]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE increases the expression of Ankyrin repeat domain-containing protein 1 (ANKRD1).	[39]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Ankyrin repeat domain-containing protein 1 (ANKRD1).	[42]

References

• [1] Ankyrin Repeat Domain 1 Overexpression is Associated with Common Resistance to Afatinib and Osimertinib in EGFR-mutant Lung Cancer.Sci Rep. 2018 Oct 5;8(1):14896. doi: 10.1038/s41598-018-33190-8.
• [2] Upregulated expression of cardiac ankyrin repeat protein in human failing hearts due to arrhythmogenic right ventricular cardiomyopathy.Eur J Heart Fail. 2009 Jun;11(6):559-66. doi: 10.1093/eurjhf/hfp049. Epub 2009 Apr 9.
• [3] Carbonic anhydrase related protein expression in astrocytomas and oligodendroglial tumors.BMC Cancer. 2018 May 23;18(1):584. doi: 10.1186/s12885-018-4493-4.
• [4] In vitro antiestrogenic effects of aryl methyl sulfone metabolites of polychlorinated biphenyls and 2,2-bis(4-chlorophenyl)-1,1-dichloroethene on 17beta-estradiol-induced gene expression in several bioassay systems.Toxicol Sci. 2002 Oct;69(2):362-72. doi: 10.1093/toxsci/69.2.362.
• [5] Multifunctional protein: cardiac ankyrin repeat protein.J Zhejiang Univ Sci B. 2016 May;17(5):333-41. doi: 10.1631/jzus.B1500247.
• [6] Ankyrin Repeat Domain 1 Protein: A Functionally Pleiotropic Protein with Cardiac Biomarker Potential.Int J Mol Sci. 2017 Jun 26;18(7):1362. doi: 10.3390/ijms18071362.
• [7] Abnormal cerebellar development and ataxia in CARP VIII morphant zebrafish.Hum Mol Genet. 2013 Feb 1;22(3):417-32. doi: 10.1093/hmg/dds438. Epub 2012 Oct 18.
• [8] Upregulated expression of cardiac ankyrin-repeated protein in renal podocytes is associated with proteinuria severity in lupus nephritis.Hum Pathol. 2007 Mar;38(3):410-9. doi: 10.1016/j.humpath.2006.09.006. Epub 2007 Jan 19.
• [9] Novel mutations in the sarcomeric protein myopalladin in patients with dilated cardiomyopathy.Eur J Hum Genet. 2013 Mar;21(3):294-300. doi: 10.1038/ejhg.2012.173. Epub 2012 Aug 15.
• [10] Mutations in the ANKRD1 gene encoding CARP are responsible for human dilated cardiomyopathy. Eur Heart J. 2009 Sep;30(17):2128-36. doi: 10.1093/eurheartj/ehp225. Epub 2009 Jun 12.
• [11] Ankyrin repeat domain 1 regulates innate immune responses against herpes simplex virus 1: Apotential role in eczema herpeticum.J Allergy Clin Immunol. 2018 Jun;141(6):2085-2093.e1. doi: 10.1016/j.jaci.2018.01.001. Epub 2018 Jan 31.
• [12] Reduction in inflammatory gene expression in skeletal muscle from Roux-en-Y gastric bypass patients randomized to omentectomy.PLoS One. 2011;6(12):e28577. doi: 10.1371/journal.pone.0028577. Epub 2011 Dec 16.
• [13] Carp, a cardiac ankyrin-repeated protein, and its new homologue, Arpp, are differentially expressed in heart, skeletal muscle, and rhabdomyosarcomas.Am J Pathol. 2002 May;160(5):1767-78. doi: 10.1016/S0002-9440(10)61123-6.
• [14] CARP is a potential tumor suppressor in gastric carcinoma and a single-nucleotide polymorphism in CARP gene might increase the risk of gastric carcinoma.PLoS One. 2014 May 28;9(5):e97743. doi: 10.1371/journal.pone.0097743. eCollection 2014.
• [15] Autophagy promotes triple negative breast cancer metastasis via YAP nuclear localization.Biochem Biophys Res Commun. 2019 Dec 3;520(2):263-268. doi: 10.1016/j.bbrc.2019.09.133. Epub 2019 Oct 5.
• [16] Altered expression of cardiac ankyrin repeat protein and its homologue, ankyrin repeat protein with PEST and proline-rich region, in atrophic muscles in amyotrophic lateral sclerosis.Pathobiology. 2002-2003;70(4):197-203. doi: 10.1159/000069329.
• [17] Myocardial overexpression of ANKRD1 causes sinus venosus defects and progressive diastolic dysfunction.Cardiovasc Res. 2020 Jul 1;116(8):1458-1472. doi: 10.1093/cvr/cvz291.
• [18] Assessment of R18, COG1410, and APP96-110 in Excitotoxicity and Traumatic Brain Injury.Transl Neurosci. 2017 Nov 15;8:147-157. doi: 10.1515/tnsci-2017-0021. eCollection 2017.
• [19] Unique transcriptome, pathways, and networks in the human endometrial fibroblast response to progesterone in endometriosis. Biol Reprod. 2011 Apr;84(4):801-15.
• [20] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [21] Ankyrin repeat domain 1, ANKRD1, a novel determinant of cisplatin sensitivity expressed in ovarian cancer.Clin Cancer Res. 2008 Nov 1;14(21):6924-32. doi: 10.1158/1078-0432.CCR-07-5189.
• [22] MUC2 gene promoter methylation in mucinous and non-mucinous colorectal cancer tissues.Int J Oncol. 2010 Apr;36(4):765-75. doi: 10.3892/ijo_00000552.
• [23] Intracellular ANKRD1 protein levels are regulated by 26S proteasome-mediated degradation.FEBS Lett. 2009 Aug 6;583(15):2486-92. doi: 10.1016/j.febslet.2009.07.001. Epub 2009 Jul 8.
• [24] RREB1-induced upregulation of the lncRNA AGAP2-AS1 regulates the proliferation and migration of pancreatic cancer partly through suppressing ANKRD1 and ANGPTL4.Cell Death Dis. 2019 Feb 27;10(3):207. doi: 10.1038/s41419-019-1384-9.
• [25] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [26] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [27] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [28] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [29] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [30] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [31] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [32] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [33] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [34] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [35] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [36] Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
• [37] High folic acid increases cell turnover and lowers differentiation and iron content in human HT29 colon cancer cells. Br J Nutr. 2008 Apr;99(4):703-8.
• [38] Cardiac toxicity from ethanol exposure in human-induced pluripotent stem cell-derived cardiomyocytes. Toxicol Sci. 2019 May 1;169(1):280-292.
• [39] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [40] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [41] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [42] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [43] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [44] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [45] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [46] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [47] Regulation of chromatin assembly and cell transformation by formaldehyde exposure in human cells. Environ Health Perspect. 2017 Sep 21;125(9):097019.
• [48] Tumor necrosis factor-alpha-induced protein 3 as a putative regulator of nuclear factor-kappaB-mediated resistance to O6-alkylating agents in human glioblastomas. J Clin Oncol. 2006 Jan 10;24(2):274-87. doi: 10.1200/JCO.2005.02.9405. Epub 2005 Dec 19.