General Information of Drug Off-Target (DOT) (ID: OTIE0W6O)

DOT Name Nectin-2 (NECTIN2)
Synonyms Herpes virus entry mediator B; Herpesvirus entry mediator B; HveB; Nectin cell adhesion molecule 2; Poliovirus receptor-related protein 2; CD antigen CD112
Gene Name NECTIN2
Related Disease
Acute myelogenous leukaemia ( )
B-cell neoplasm ( )
Acute monocytic leukemia ( )
Age-related macular degeneration ( )
Arteriosclerosis ( )
Autoimmune disease ( )
Breast cancer ( )
Breast carcinoma ( )
Breast neoplasm ( )
Coronary heart disease ( )
Endometrial carcinoma ( )
Epithelial ovarian cancer ( )
Esophageal squamous cell carcinoma ( )
Familial Alzheimer disease ( )
Herpes simplex infection ( )
Lung cancer ( )
Lung carcinoma ( )
Mantle cell lymphoma ( )
Matthew-Wood syndrome ( )
Neoplasm ( )
Non-hodgkin lymphoma ( )
Non-insulin dependent diabetes ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Parkinson disease ( )
Primary cutaneous peripheral T-cell lymphoma not otherwise specified ( )
Prostate carcinoma ( )
Prostate neoplasm ( )
Spermatogenic failure 6 ( )
Systemic lupus erythematosus ( )
Systemic sclerosis ( )
T-cell lymphoma ( )
Dementia ( )
Ewing sarcoma ( )
leukaemia ( )
Leukemia ( )
Poliomyelitis ( )
Advanced cancer ( )
Alzheimer disease ( )
Atherosclerosis ( )
B-cell lymphoma ( )
Carcinoma of liver and intrahepatic biliary tract ( )
Liver cancer ( )
Prostate cancer ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
UniProt ID
NECT2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
3R0N; 4DFH; 4DFI; 4HZA; 5V52
Pfam ID
PF08205 ; PF07686
Sequence
MARAAALLPSRSPPTPLLWPLLLLLLLETGAQDVRVQVLPEVRGQLGGTVELPCHLLPPV
PGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAEL
QDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTV
ALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKV
EHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTS
GTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGG
IIGGIIAAIIATAVAATGILICRQQRKEQTLQGAEEDEDLEGPPSYKPPTPKAKLEAQEM
PSQLFTLGASEHSPLKTPYFDAGASCTEQEMPRYHELPTLEERSGPLHPGATSLGSPIPV
PPGPPAVEDVSLDLEDEEGEEEEEYLDKINPIYDALSYSSPSDSYQGKGFVMSRAMYV
Function
Modulator of T-cell signaling. Can be either a costimulator of T-cell function, or a coinhibitor, depending on the receptor it binds to. Upon binding to CD226, stimulates T-cell proliferation and cytokine production, including that of IL2, IL5, IL10, IL13, and IFNG. Upon interaction with PVRIG, inhibits T-cell proliferation. These interactions are competitive. Probable cell adhesion protein ; (Microbial infection) Acts as a receptor for herpes simplex virus 1 (HHV-1) mutant Rid1, herpes simplex virus 1 (HHV-2) and pseudorabies virus (PRV).
Tissue Specificity Ubiquitous.
KEGG Pathway
Virion - Herpesvirus (hsa03266 )
Cell adhesion molecules (hsa04514 )
Adherens junction (hsa04520 )
Herpes simplex virus 1 infection (hsa05168 )
Reactome Pathway
Adherens junctions interactions (R-HSA-418990 )
Nectin/Necl trans heterodimerization (R-HSA-420597 )
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933 )

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Acute myelogenous leukaemia DISCSPTN Definitive Biomarker [1]
B-cell neoplasm DISVY326 Definitive Biomarker [2]
Acute monocytic leukemia DIS28NEL Strong Biomarker [3]
Age-related macular degeneration DIS0XS2C Strong Genetic Variation [4]
Arteriosclerosis DISK5QGC Strong Biomarker [5]
Autoimmune disease DISORMTM Strong Biomarker [6]
Breast cancer DIS7DPX1 Strong Therapeutic [7]
Breast carcinoma DIS2UE88 Strong Therapeutic [7]
Breast neoplasm DISNGJLM Strong Therapeutic [7]
Coronary heart disease DIS5OIP1 Strong Biomarker [8]
Endometrial carcinoma DISXR5CY Strong Altered Expression [9]
Epithelial ovarian cancer DIS56MH2 Strong Biomarker [10]
Esophageal squamous cell carcinoma DIS5N2GV Strong Altered Expression [11]
Familial Alzheimer disease DISE75U4 Strong Biomarker [12]
Herpes simplex infection DISL1SAV Strong Biomarker [13]
Lung cancer DISCM4YA Strong Biomarker [14]
Lung carcinoma DISTR26C Strong Biomarker [14]
Mantle cell lymphoma DISFREOV Strong Altered Expression [15]
Matthew-Wood syndrome DISA7HR7 Strong Altered Expression [16]
Neoplasm DISZKGEW Strong Altered Expression [10]
Non-hodgkin lymphoma DISS2Y8A Strong Altered Expression [15]
Non-insulin dependent diabetes DISK1O5Z Strong Genetic Variation [17]
Ovarian cancer DISZJHAP Strong Biomarker [10]
Ovarian neoplasm DISEAFTY Strong Biomarker [10]
Parkinson disease DISQVHKL Strong Biomarker [18]
Primary cutaneous peripheral T-cell lymphoma not otherwise specified DIS5OHQF Strong Biomarker [19]
Prostate carcinoma DISMJPLE Strong Altered Expression [20]
Prostate neoplasm DISHDKGQ Strong Biomarker [20]
Spermatogenic failure 6 DISCK87Z Strong Biomarker [21]
Systemic lupus erythematosus DISI1SZ7 Strong Altered Expression [22]
Systemic sclerosis DISF44L6 Strong Biomarker [23]
T-cell lymphoma DISSXRTQ Strong Altered Expression [24]
Dementia DISXL1WY moderate Genetic Variation [25]
Ewing sarcoma DISQYLV3 moderate Altered Expression [26]
leukaemia DISS7D1V moderate Altered Expression [26]
Leukemia DISNAKFL moderate Altered Expression [26]
Poliomyelitis DISANFJN moderate Altered Expression [27]
Advanced cancer DISAT1Z9 Limited Altered Expression [9]
Alzheimer disease DISF8S70 Limited Genetic Variation [28]
Atherosclerosis DISMN9J3 Limited Biomarker [5]
B-cell lymphoma DISIH1YQ Limited Biomarker [24]
Carcinoma of liver and intrahepatic biliary tract DIS8WA0W Limited Biomarker [29]
Liver cancer DISDE4BI Limited Biomarker [29]
Prostate cancer DISF190Y Limited Altered Expression [20]
Urinary bladder cancer DISDV4T7 Limited Biomarker [30]
Urinary bladder neoplasm DIS7HACE Limited Biomarker [30]
------------------------------------------------------------------------------------
⏷ Show the Full List of 46 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Methotrexate DM2TEOL Approved Nectin-2 (NECTIN2) affects the response to substance of Methotrexate. [45]
------------------------------------------------------------------------------------
12 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Nectin-2 (NECTIN2). [31]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Nectin-2 (NECTIN2). [32]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Nectin-2 (NECTIN2). [33]
Estradiol DMUNTE3 Approved Estradiol affects the expression of Nectin-2 (NECTIN2). [34]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Nectin-2 (NECTIN2). [35]
Selenium DM25CGV Approved Selenium increases the expression of Nectin-2 (NECTIN2). [36]
Clozapine DMFC71L Approved Clozapine decreases the expression of Nectin-2 (NECTIN2). [37]
Benzatropine DMF7EXL Approved Benzatropine decreases the expression of Nectin-2 (NECTIN2). [37]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Nectin-2 (NECTIN2). [39]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Nectin-2 (NECTIN2). [42]
Coumestrol DM40TBU Investigative Coumestrol decreases the expression of Nectin-2 (NECTIN2). [43]
CH-223191 DMMJZYC Investigative CH-223191 decreases the expression of Nectin-2 (NECTIN2). [44]
------------------------------------------------------------------------------------
⏷ Show the Full List of 12 Drug(s)
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Nectin-2 (NECTIN2). [38]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Nectin-2 (NECTIN2). [40]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Nectin-2 (NECTIN2). [41]
------------------------------------------------------------------------------------

References

1 Monitoring TIGIT/DNAM-1 and PVR/PVRL2 Immune Checkpoint Expression Levels in Allogeneic Stem Cell Transplantation for Acute Myeloid Leukemia.Biol Blood Marrow Transplant. 2019 May;25(5):861-867. doi: 10.1016/j.bbmt.2019.01.013. Epub 2019 Jan 11.
2 Gene signature in Alzheimer's disease and environmental factors: the virus chronicle.J Alzheimers Dis. 2011;27(4):809-17. doi: 10.3233/JAD-2011-110755.
3 Immune checkpoints PVR and PVRL2 are prognostic markers in AML and their blockade represents a new therapeutic option.Oncogene. 2018 Sep;37(39):5269-5280. doi: 10.1038/s41388-018-0288-y. Epub 2018 May 31.
4 Insights into the genetic architecture of early stage age-related macular degeneration: a genome-wide association study meta-analysis.PLoS One. 2013;8(1):e53830. doi: 10.1371/journal.pone.0053830. Epub 2013 Jan 11.
5 Poliovirus Receptor-Related 2: A Cholesterol-Responsive Gene Affecting Atherosclerosis Development by Modulating Leukocyte Migration.Arterioscler Thromb Vasc Biol. 2017 Mar;37(3):534-542. doi: 10.1161/ATVBAHA.116.308715. Epub 2017 Jan 5.
6 Structural, mutational and biophysical studies reveal a canonical mode of molecular recognition between immune receptor TIGIT and nectin-2.Mol Immunol. 2017 Jan;81:151-159. doi: 10.1016/j.molimm.2016.12.003. Epub 2016 Dec 12.
7 Nectin-2 is a potential target for antibody therapy of breast and ovarian cancers.Mol Cancer. 2013 Jun 12;12:60. doi: 10.1186/1476-4598-12-60.
8 An integrated genomic-transcriptomic approach supports a role for the proto-oncogene BCL3 in atherosclerosis.Thromb Haemost. 2015 Mar;113(3):655-63. doi: 10.1160/TH14-05-0466. Epub 2014 Nov 6.
9 PVRIG and PVRL2 Are Induced in Cancer and Inhibit CD8(+) T-cell Function.Cancer Immunol Res. 2019 Feb;7(2):257-268. doi: 10.1158/2326-6066.CIR-18-0442. Epub 2019 Jan 18.
10 Nectin-2 in ovarian cancer: How is it expressed and what might be its functional role?.Cancer Sci. 2019 Jun;110(6):1872-1882. doi: 10.1111/cas.13992. Epub 2019 May 2.
11 Elevated Nectin-2 expression is involved in esophageal squamous cell carcinoma by promoting cell migration and invasion.Oncol Lett. 2018 Apr;15(4):4731-4736. doi: 10.3892/ol.2018.7953. Epub 2018 Feb 5.
12 Hidden heterogeneity in Alzheimer's disease: Insights from genetic association studies and other analyses.Exp Gerontol. 2018 Jul 1;107:148-160. doi: 10.1016/j.exger.2017.10.020. Epub 2017 Oct 26.
13 Genome-Wide Association and Mechanistic Studies Indicate That Immune Response Contributes to Alzheimer's Disease Development.Front Genet. 2018 Sep 24;9:410. doi: 10.3389/fgene.2018.00410. eCollection 2018.
14 Serum nectin-2 and nectin-4 are diagnostic in lung cancer: which is superior?.Wien Klin Wochenschr. 2019 Sep;131(17-18):419-426. doi: 10.1007/s00508-019-01537-4. Epub 2019 Aug 22.
15 TIGIT and PD-1 Mark Intratumoral T Cells with Reduced Effector Function in B-cell Non-Hodgkin Lymphoma.Cancer Immunol Res. 2019 Mar;7(3):355-362. doi: 10.1158/2326-6066.CIR-18-0351. Epub 2019 Jan 18.
16 The Clinical and Pathological Significance of Nectin-2 and DDX3 Expression in Pancreatic Ductal Adenocarcinomas.Dis Markers. 2015;2015:379568. doi: 10.1155/2015/379568. Epub 2015 Jul 30.
17 Multi-ethnic genome-wide association study identifies novel locus for type 2 diabetes susceptibility.Eur J Hum Genet. 2016 Aug;24(8):1175-80. doi: 10.1038/ejhg.2016.17. Epub 2016 May 18.
18 Identification of candidate genes for Parkinson's disease through blood transcriptome analysis in LRRK2-G2019S carriers, idiopathic cases, and controls.Neurobiol Aging. 2015 Feb;36(2):1105-9. doi: 10.1016/j.neurobiolaging.2014.10.039. Epub 2014 Nov 5.
19 Peripheral T-cell lymphoma cell line T8ML-1 highlights conspicuous targeting of PVRL2 by t(14;19)(q11.2;q13.3).Haematologica. 2017 Sep;102(9):e356-e359. doi: 10.3324/haematol.2017.168203. Epub 2017 Jun 28.
20 Identification of targets for prostate cancer immunotherapy.Prostate. 2019 Apr;79(5):498-505. doi: 10.1002/pros.23756. Epub 2019 Jan 6.
21 Detection of candidate nectin gene mutations in infertile men with severe teratospermia.J Assist Reprod Genet. 2017 Oct;34(10):1295-1302. doi: 10.1007/s10815-017-0985-4. Epub 2017 Jul 8.
22 Gene profiling involved in immature CD4+ T lymphocyte responsible for systemic lupus erythematosus.Mol Immunol. 2006 Mar;43(9):1497-507. doi: 10.1016/j.molimm.2005.07.039. Epub 2005 Sep 6.
23 Histone Deacetylase 5 Is Overexpressed in Scleroderma Endothelial Cells and Impairs Angiogenesis via Repression of Proangiogenic Factors.Arthritis Rheumatol. 2016 Dec;68(12):2975-2985. doi: 10.1002/art.39828.
24 Novel IGH and MYC Translocation Partners in Diffuse Large B-Cell Lymphomas.Genes Chromosomes Cancer. 2016 Dec;55(12):932-943. doi: 10.1002/gcc.22391. Epub 2016 Jul 12.
25 Genome-wide association meta-analysis of neuropathologic features of Alzheimer's disease and related dementias.PLoS Genet. 2014 Sep 4;10(9):e1004606. doi: 10.1371/journal.pgen.1004606. eCollection 2014 Sep.
26 DNAM-1-based chimeric antigen receptors enhance T cell effector function and exhibit in vivo efficacy against melanoma.Cancer Immunol Immunother. 2015 Apr;64(4):409-18. doi: 10.1007/s00262-014-1648-2. Epub 2014 Dec 31.
27 In Vitro Killing of Colorectal Carcinoma Cells by Autologous Activated NK Cells is Boosted by Anti-Epidermal Growth Factor Receptor-induced ADCC Regardless of RAS Mutation Status.J Immunother. 2018 May;41(4):190-200. doi: 10.1097/CJI.0000000000000205.
28 Shared genetic architecture between metabolic traits and Alzheimer's disease: a large-scale genome-wide cross-trait analysis.Hum Genet. 2019 Mar;138(3):271-285. doi: 10.1007/s00439-019-01988-9. Epub 2019 Feb 25.
29 Integrated Genomic Comparison of Mouse Models Reveals Their Clinical Resemblance to Human Liver Cancer.Mol Cancer Res. 2018 Nov;16(11):1713-1723. doi: 10.1158/1541-7786.MCR-18-0313. Epub 2018 Aug 6.
30 Identification and validation of an 18-gene signature highly-predictive of bladder cancer metastasis.Sci Rep. 2018 Jan 10;8(1):374. doi: 10.1038/s41598-017-18773-1.
31 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
32 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
33 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
34 Identification of novel low-dose bisphenol a targets in human foreskin fibroblast cells derived from hypospadias patients. PLoS One. 2012;7(5):e36711. doi: 10.1371/journal.pone.0036711. Epub 2012 May 4.
35 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
36 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
37 Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
38 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
39 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
40 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
41 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
42 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
43 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
44 Adaptive changes in global gene expression profile of lung carcinoma A549 cells acutely exposed to distinct types of AhR ligands. Toxicol Lett. 2018 Aug;292:162-174.
45 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.