Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJM4A0R)

DOT Name Acidic amino acid decarboxylase GADL1 (GADL1)
Synonyms Aspartate 1-decarboxylase; ADC; HuADC; EC 4.1.1.11; Cysteine sulfinic acid decarboxylase; CSADC; HuCSADC; EC 4.1.1.29; Glutamate decarboxylase-like protein 1
Gene Name GADL1
Related Disease
Bipolar I disorder ( )
Melanoma ( )
Acute myocardial infarction ( )
Adult glioblastoma ( )
Advanced cancer ( )
Alzheimer disease ( )
Bipolar disorder ( )
Brain neoplasm ( )
Cholangiocarcinoma ( )
Chromosomal disorder ( )
Colitis ( )
Crohn disease ( )
Cytomegalovirus infection ( )
Esophageal squamous cell carcinoma ( )
Glioblastoma multiforme ( )
Glioma ( )
Head-neck squamous cell carcinoma ( )
Hepatocellular carcinoma ( )
Liver cancer ( )
Liver cirrhosis ( )
Lung neoplasm ( )
Malignant glioma ( )
Prostate neoplasm ( )
Rectal carcinoma ( )
Retinoblastoma ( )
Small-cell lung cancer ( )
Stroke ( )
Trigeminal neuralgia ( )
Ulcerative colitis ( )
Carcinoma ( )
Intrahepatic cholangiocarcinoma ( )
Metastatic malignant neoplasm ( )
Neuroblastoma ( )
Adenocarcinoma ( )
Amyotrophic lateral sclerosis ( )
Breast cancer ( )
Breast carcinoma ( )
Chronic kidney disease ( )
Chronic obstructive pulmonary disease ( )
Clear cell renal carcinoma ( )
Colorectal carcinoma ( )
Endometrial cancer ( )
Endometrial carcinoma ( )
Nasopharyngeal carcinoma ( )
Pancreatic cancer ( )
Plasma cell myeloma ( )
Prostate cancer ( )
Prostate carcinoma ( )
UniProt ID
GADL1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
4.1.1.11; 4.1.1.29
Pfam ID
PF00282
Sequence
MSSDSDRQCPVDGDIDQQEMIPSKKNAVLVDGVVLNGPTTDAKAGEKFVEEACRLIMEEV
VLKATDVNEKVCEWRPPEQLKQLLDLEMRDSGEPPHKLLELCRDVIHYSVKTNHPRFFNQ
LYAGLDYYSLVARFMTEALNPSVYTYEVSPVFLLVEEAVLKKMIEFIGWKEGDGIFNPGG
SVSNMYAMNLARYKYCPDIKEKGLSGSPRLILFTSAECHYSMKKAASFLGIGTENVCFVE
TDGRGKMIPEELEKQVWQARKEGAAPFLVCATSGTTVLGAFDPLDEIADICERHSLWLHV
DASWGGSALMSRKHRKLLHGIHRADSVAWNPHKMLMAGIQCCALLVKDKSDLLKKCYSAK
ASYLFQQDKFYDVSYDTGDKSIQCSRRPDAFKFWMTWKALGTLGLEERVNRALALSRYLV
DEIKKREGFKLLMEPEYANICFWYIPPSLREMEEGPEFWAKLNLVAPAIKERMMKKGSLM
LGYQPHRGKVNFFRQVVISPQVSREDMDFLLDEIDLLGKDM
Function
May catalyze the decarboxylation of L-aspartate, 3-sulfino-L-alanine (cysteine sulfinic acid), and L-cysteate to beta-alanine, hypotaurine and taurine, respectively. Does not exhibit any decarboxylation activity toward glutamate.
Tissue Specificity Expressed very weakly in neurons and not detected in astrocytes, brain or liver.
KEGG Pathway
beta-Alanine metabolism (hsa00410 )
Taurine and hypotaurine metabolism (hsa00430 )
Pantothe.te and CoA biosynthesis (hsa00770 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Aspartate and asparagine metabolism (R-HSA-8963693 )
Degradation of cysteine and homocysteine (R-HSA-1614558 )

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Bipolar I disorder DISD09EH Definitive Genetic Variation [1]
Melanoma DIS1RRCY Definitive Biomarker [2]
Acute myocardial infarction DISE3HTG Strong Biomarker [3]
Adult glioblastoma DISVP4LU Strong Biomarker [4]
Advanced cancer DISAT1Z9 Strong Biomarker [5]
Alzheimer disease DISF8S70 Strong Biomarker [6]
Bipolar disorder DISAM7J2 Strong Altered Expression [7]
Brain neoplasm DISY3EKS Strong Biomarker [8]
Cholangiocarcinoma DIS71F6X Strong Biomarker [9]
Chromosomal disorder DISM5BB5 Strong Genetic Variation [10]
Colitis DISAF7DD Strong Biomarker [11]
Crohn disease DIS2C5Q8 Strong Biomarker [12]
Cytomegalovirus infection DISCEMGC Strong Biomarker [13]
Esophageal squamous cell carcinoma DIS5N2GV Strong Biomarker [14]
Glioblastoma multiforme DISK8246 Strong Biomarker [15]
Glioma DIS5RPEH Strong Biomarker [16]
Head-neck squamous cell carcinoma DISF7P24 Strong Biomarker [17]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [5]
Liver cancer DISDE4BI Strong Biomarker [18]
Liver cirrhosis DIS4G1GX Strong Biomarker [19]
Lung neoplasm DISVARNB Strong Biomarker [20]
Malignant glioma DISFXKOV Strong Biomarker [21]
Prostate neoplasm DISHDKGQ Strong Biomarker [22]
Rectal carcinoma DIS8FRR7 Strong Biomarker [23]
Retinoblastoma DISVPNPB Strong Biomarker [24]
Small-cell lung cancer DISK3LZD Strong Biomarker [25]
Stroke DISX6UHX Strong Biomarker [26]
Trigeminal neuralgia DIS31ZY6 Strong Biomarker [27]
Ulcerative colitis DIS8K27O Strong Biomarker [11]
Carcinoma DISH9F1N moderate Altered Expression [28]
Intrahepatic cholangiocarcinoma DIS6GOC8 moderate Biomarker [29]
Metastatic malignant neoplasm DIS86UK6 Disputed Biomarker [30]
Neuroblastoma DISVZBI4 Disputed Biomarker [31]
Adenocarcinoma DIS3IHTY Limited Biomarker [32]
Amyotrophic lateral sclerosis DISF7HVM Limited Biomarker [33]
Breast cancer DIS7DPX1 Limited Biomarker [34]
Breast carcinoma DIS2UE88 Limited Biomarker [34]
Chronic kidney disease DISW82R7 Limited Biomarker [35]
Chronic obstructive pulmonary disease DISQCIRF Limited Biomarker [36]
Clear cell renal carcinoma DISBXRFJ Limited Biomarker [37]
Colorectal carcinoma DIS5PYL0 Limited Biomarker [38]
Endometrial cancer DISW0LMR Limited Biomarker [39]
Endometrial carcinoma DISXR5CY Limited Biomarker [39]
Nasopharyngeal carcinoma DISAOTQ0 Limited Biomarker [40]
Pancreatic cancer DISJC981 Limited Biomarker [41]
Plasma cell myeloma DIS0DFZ0 Limited Biomarker [42]
Prostate cancer DISF190Y Limited Biomarker [43]
Prostate carcinoma DISMJPLE Limited Biomarker [43]
------------------------------------------------------------------------------------
⏷ Show the Full List of 48 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Acidic amino acid decarboxylase GADL1 (GADL1). [44]
------------------------------------------------------------------------------------

References

1 Immunophenotypes associated with bipolar disorder and lithium treatment.Sci Rep. 2019 Nov 25;9(1):17453. doi: 10.1038/s41598-019-53745-7.
2 EV20-mediated delivery of cytotoxic auristatin MMAF exhibits potent therapeutic efficacy in cutaneous melanoma.J Control Release. 2018 May 10;277:48-56. doi: 10.1016/j.jconrel.2018.03.016. Epub 2018 Mar 14.
3 Simultaneous measurement of T(2) and apparent diffusion coefficient (T(2) +ADC) in the heart with motion-compensated spin echo diffusion-weighted imaging.Magn Reson Med. 2018 Feb;79(2):654-662. doi: 10.1002/mrm.26705. Epub 2017 May 17.
4 Comparison between MRI-derived ADC maps and (18)FLT-PET in pre-operative glioblastoma.J Neuroradiol. 2019 Nov;46(6):359-366. doi: 10.1016/j.neurad.2019.05.011. Epub 2019 Jun 20.
5 Comparison of pulsed and oscillating gradient diffusion-weighted MRI for characterizing hepatocellular nodules in liver cirrhosis: ex vivo study in a rat model.J Magn Reson Imaging. 2020 Apr;51(4):1065-1074. doi: 10.1002/jmri.26919. Epub 2019 Sep 11.
6 Genetic assessment of age-associated Alzheimer disease risk: Development and validation of a polygenic hazard score.PLoS Med. 2017 Mar 21;14(3):e1002258. doi: 10.1371/journal.pmed.1002258. eCollection 2017 Mar.
7 Lithium response in bipolar disorder: No difference in GADL1 gene expression between cell lines from excellent-responders and non-responders.Psychiatry Res. 2017 May;251:217-220. doi: 10.1016/j.psychres.2017.02.022. Epub 2017 Feb 14.
8 Multiparametric Analysis of Permeability and ADC Histogram Metrics for Classification of Pediatric Brain Tumors by Tumor Grade.AJNR Am J Neuroradiol. 2018 Mar;39(3):552-557. doi: 10.3174/ajnr.A5502. Epub 2018 Jan 4.
9 Differences in corpus callosum injury between cerebral concussion and diffuse axonal injury.Medicine (Baltimore). 2019 Oct;98(41):e17467. doi: 10.1097/MD.0000000000017467.
10 Chromosome abnormalities in non-small cell lung cancer pleural effusions: cytogenetic indicators of disease subgroups.Genes Chromosomes Cancer. 1993 Dec;8(4):262-9. doi: 10.1002/gcc.2870080409.
11 Colitis Is Effectively Ameliorated by ()-8-Acetonyl-dihydrocoptisine via the XBP1-NF-B Pathway.Front Pharmacol. 2017 Sep 5;8:619. doi: 10.3389/fphar.2017.00619. eCollection 2017.
12 Diffusion-weighted magnetic resonance enterography for prediction of response to tumor necrosis factor inhibitors in stricturing Crohn's disease.Abdom Radiol (NY). 2018 Dec;43(12):3207-3212. doi: 10.1007/s00261-018-1626-9.
13 Apparent Diffusion Coefficient Levels and Neurodevelopmental Outcome in Fetuses with Brain MR Imaging White Matter Hyperintense Signal.AJNR Am J Neuroradiol. 2018 Oct;39(10):1926-1931. doi: 10.3174/ajnr.A5802. Epub 2018 Sep 6.
14 Role of intravoxel incoherent motion MRI in early assessment of the response of esophageal squamous cell carcinoma to chemoradiotherapy: A pilot study.J Magn Reson Imaging. 2018 Aug;48(2):349-358. doi: 10.1002/jmri.25934. Epub 2018 Jan 3.
15 Evaluation of the apparent diffusion coefficient in patients with recurrent glioblastoma under treatment with bevacizumab with radiographic pseudoresponse.J Neuroradiol. 2019 Feb;46(1):36-43. doi: 10.1016/j.neurad.2018.04.002. Epub 2018 May 4.
16 Predicting Genotype and Survival in Glioma Using Standard Clinical MR Imaging Apparent Diffusion Coefficient Images: A Pilot Study from The Cancer Genome Atlas.AJNR Am J Neuroradiol. 2018 Oct;39(10):1814-1820. doi: 10.3174/ajnr.A5794. Epub 2018 Sep 6.
17 Data-Driven prioritisation of antibody-drug conjugate targets in head and neck squamous cell carcinoma.Oral Oncol. 2018 May;80:33-39. doi: 10.1016/j.oraloncology.2018.03.005. Epub 2018 Mar 27.
18 Multiple genes exhibit phenobarbital-induced constitutive active/androstane receptor-mediated DNA methylation changes during liver tumorigenesis and in liver tumors.Toxicol Sci. 2009 Apr;108(2):273-89. doi: 10.1093/toxsci/kfp031. Epub 2009 Feb 20.
19 ADC similarity predicts microvascular invasion of bifocal hepatocellular carcinoma.Abdom Radiol (NY). 2018 Sep;43(9):2295-2302. doi: 10.1007/s00261-018-1469-4.
20 Heterogeneity of large cell carcinoma of the lung: an immunophenotypic and miRNA-based analysis.Am J Clin Pathol. 2011 Nov;136(5):773-82. doi: 10.1309/AJCPYY79XAGRAYCJ.
21 DWI for Monitoring the Acute Response of Malignant Gliomas to Photodynamic Therapy.AJNR Am J Neuroradiol. 2019 Dec;40(12):2045-2051. doi: 10.3174/ajnr.A6300. Epub 2019 Nov 21.
22 Dynamic diffusion-weighted hyperpolarized (13) C imaging based on a slice-selective double spin echo sequence for measurements of cellular transport.Magn Reson Med. 2019 Mar;81(3):2001-2010. doi: 10.1002/mrm.27501. Epub 2018 Oct 28.
23 Could IVIM and ADC help in predicting the KRAS status in patients with rectal cancer?.Eur Radiol. 2018 Jul;28(7):3059-3065. doi: 10.1007/s00330-018-5329-y. Epub 2018 Feb 15.
24 Correlation between conventional MR imaging combined with diffusion-weighted imaging and histopathologic findings in eyes primarily enucleated for advanced retinoblastoma: a retrospective study.Eur Radiol. 2018 Feb;28(2):620-629. doi: 10.1007/s00330-017-4993-7. Epub 2017 Aug 7.
25 Clinical significance of serum miR-25 in non-small-cell lung cancer.Br J Biomed Sci. 2019 Jul;76(3):111-116. doi: 10.1080/09674845.2019.1592915. Epub 2019 May 14.
26 Effects of Xiaoshuan Enteric-Coated Capsule on White and Gray Matter Injury Evaluated by Diffusion Tensor Imaging in Ischemic Stroke.Cell Transplant. 2019 Jun;28(6):671-683. doi: 10.1177/0963689718802755. Epub 2018 Oct 4.
27 Differentiation of triple-negative breast cancer from other subtypes through whole-tumor histogram analysis on multiparametric MR imaging.Eur Radiol. 2019 May;29(5):2535-2544. doi: 10.1007/s00330-018-5804-5. Epub 2018 Nov 6.
28 Antitumor activity of a 5T4 targeting antibody drug conjugate with a novel payload derived from MMAF via C-Lock linker.Cancer Med. 2019 Apr;8(4):1793-1805. doi: 10.1002/cam4.2066. Epub 2019 Mar 7.
29 Differentiation of hypervascular primary hepatic tumors showing hepatobiliary hypointensity on gadoxetic acid-enhanced magnetic resonance imaging.Abdom Radiol (NY). 2019 Sep;44(9):3115-3126. doi: 10.1007/s00261-019-02068-2.
30 Considering tumour volume for motion corrected DWI of colorectal liver metastases increases sensitivity of ADC to detect treatment-induced changes.Sci Rep. 2019 Mar 7;9(1):3828. doi: 10.1038/s41598-019-40565-y.
31 Effects of GADL1 overexpression on cell migration and the associated morphological changes.Sci Rep. 2019 Mar 28;9(1):5298. doi: 10.1038/s41598-019-41689-x.
32 Significance of (18)F-FDG PET Parameters According to Histologic Subtype in the Treatment Outcome of Stage III Non-small-cell Lung Cancer Undergoing Definitive Concurrent Chemoradiotherapy.Clin Lung Cancer. 2019 Jan;20(1):e9-e23. doi: 10.1016/j.cllc.2018.08.018. Epub 2018 Aug 30.
33 Ultra-High Field Diffusion MRI Reveals Early Axonal Pathology in Spinal Cord of ALS mice.Transl Neurodegener. 2018 Aug 8;7:20. doi: 10.1186/s40035-018-0122-z. eCollection 2018.
34 Novel ADC Solidifies Role in Breast Cancer.Cancer Discov. 2020 Feb;10(2):167. doi: 10.1158/2159-8290.CD-NB2019-139. Epub 2019 Dec 16.
35 Comparison of readout-segmented and conventional single-shot for echo-planar diffusion-weighted imaging in the assessment of kidney interstitial fibrosis.J Magn Reson Imaging. 2017 Dec;46(6):1631-1640. doi: 10.1002/jmri.25687. Epub 2017 Mar 10.
36 Multibreath Hyperpolarized (3)He Imaging Scheme to Measure Alveolar Oxygen Tension and Apparent Diffusion Coefficient.Acad Radiol. 2019 Mar;26(3):367-382. doi: 10.1016/j.acra.2018.10.001. Epub 2019 Jan 8.
37 Whole-Tumor Quantitative Apparent Diffusion Coefficient Histogram and Texture Analysis to Differentiation of Minimal Fat Angiomyolipoma from Clear Cell Renal Cell Carcinoma.Acad Radiol. 2019 May;26(5):632-639. doi: 10.1016/j.acra.2018.06.015. Epub 2018 Aug 5.
38 The antibody-drug conjugate target landscape across a broad range of tumour types.Ann Oncol. 2017 Dec 1;28(12):3083-3091. doi: 10.1093/annonc/mdx541.
39 Utility of diffusion-weighted imaging in association with pathologic upgrading in biopsy-proven grade I endometrial cancer.J Magn Reson Imaging. 2020 Jan;51(1):117-123. doi: 10.1002/jmri.26840. Epub 2019 Jun 17.
40 Treatment Response Prediction of Nasopharyngeal Carcinoma Based on Histogram Analysis of Diffusional Kurtosis Imaging.AJNR Am J Neuroradiol. 2019 Feb;40(2):326-333. doi: 10.3174/ajnr.A5925. Epub 2019 Jan 10.
41 Author Correction: Targeting CLDN18.2 by CD3 Bispecific and ADC Modalities for the Treatments of Gastric and Pancreatic Cancer.Sci Rep. 2019 Nov 8;9(1):16735. doi: 10.1038/s41598-019-53130-4.
42 The Role of B-Cell Maturation Antigen in the Biology and Management of, and as a Potential Therapeutic Target in, Multiple Myeloma.Target Oncol. 2018 Feb;13(1):39-47. doi: 10.1007/s11523-017-0538-x.
43 Revisiting quantitative multi-parametric MRI of benign prostatic hyperplasia and its differentiation from transition zone cancer.Abdom Radiol (NY). 2019 Jun;44(6):2233-2243. doi: 10.1007/s00261-019-01936-1.
44 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.