Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJSWMOD)

• DOT Name: 28 kDa heat- and acid-stable phosphoprotein (PDAP1)
• Synonyms: PDGF-associated protein; PAP; PDGFA-associated protein 1; PAP1
• Gene Name: PDAP1
• Related Disease:
  Bacteremia
  Obstructive sleep apnea
  Parkinson disease
  Adult glioblastoma
  Androgen insensitivity syndrome
  Arrhythmia
  Atrial fibrillation
  Autosomal dominant optic atrophy, classic form
  Carcinoma
  Cervical cancer
  Cervical carcinoma
  Cervical Intraepithelial neoplasia
  Childhood acute lymphoblastic leukemia
  Classic Hodgkin lymphoma
  Dysplasia of cervix
  Glioblastoma multiforme
  Glioma
  Hepatitis B virus infection
  Human papillomavirus infection
  Huntington disease
  leukaemia
  Leukemia
  Lipodystrophy
  Male infertility
  Neuralgia
  Non-insulin dependent diabetes
  Obesity
  Pancreatic cancer
  Post-traumatic stress disorder
  Precancerous condition
  Pyelonephritis
  Scleroderma
  Severe combined immunodeficiency
  Sleep apnea syndrome
  Systemic lupus erythematosus
  Systemic sclerosis
  Type-1/2 diabetes
  Cholangiocarcinoma
  Methicillin-resistant staphylococci infection
  Pulmonary emphysema
  Neoplasm
  Amyotrophic lateral sclerosis
  Chronic obstructive pulmonary disease
  Colitis
  Colorectal carcinoma
  Pancreatitis
  Psychotic disorder
• UniProt ID: HAP28_HUMAN
• Pfam ID: PF10252
• Sequence:
  MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDS
  DESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKA
  KERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLN
  K
• Function: Enhances PDGFA-stimulated cell growth in fibroblasts, but inhibits the mitogenic effect of PDGFB.
• Reactome Pathway: Neutrophil degranulation (R-HSA-6798695)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Bacteremia	DIS6N9RZ	Definitive	Biomarker	[1]
Obstructive sleep apnea	DIS0SVD1	Definitive	Biomarker	[2]
Parkinson disease	DISQVHKL	Definitive	Biomarker	[3]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[4]
Androgen insensitivity syndrome	DISUZBBO	Strong	Biomarker	[5]
Arrhythmia	DISFF2NI	Strong	Biomarker	[6]
Atrial fibrillation	DIS15W6U	Strong	Biomarker	[6]
Autosomal dominant optic atrophy, classic form	DISXUAV9	Strong	Biomarker	[7]
Carcinoma	DISH9F1N	Strong	Biomarker	[8]
Cervical cancer	DISFSHPF	Strong	Biomarker	[9]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[9]
Cervical Intraepithelial neoplasia	DISXP757	Strong	Genetic Variation	[10]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Strong	Biomarker	[11]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Biomarker	[12]
Dysplasia of cervix	DISOAROS	Strong	Genetic Variation	[10]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[4]
Glioma	DIS5RPEH	Strong	Altered Expression	[13]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[14]
Human papillomavirus infection	DISX61LX	Strong	Genetic Variation	[15]
Huntington disease	DISQPLA4	Strong	Biomarker	[12]
leukaemia	DISS7D1V	Strong	Altered Expression	[16]
Leukemia	DISNAKFL	Strong	Genetic Variation	[16]
Lipodystrophy	DIS3SGVD	Strong	Biomarker	[17]
Male infertility	DISY3YZZ	Strong	Altered Expression	[18]
Neuralgia	DISWO58J	Strong	Biomarker	[19]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Altered Expression	[20]
Obesity	DIS47Y1K	Strong	Biomarker	[21]
Pancreatic cancer	DISJC981	Strong	Biomarker	[22]
Post-traumatic stress disorder	DISHL1EY	Strong	Biomarker	[23]
Precancerous condition	DISV06FL	Strong	Biomarker	[24]
Pyelonephritis	DISAOX93	Strong	Biomarker	[25]
Scleroderma	DISVQ342	Strong	Biomarker	[26]
Severe combined immunodeficiency	DIS6MF4Q	Strong	Biomarker	[16]
Sleep apnea syndrome	DISER6KS	Strong	Biomarker	[27]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[28]
Systemic sclerosis	DISF44L6	Strong	Biomarker	[26]
Type-1/2 diabetes	DISIUHAP	Strong	Altered Expression	[29]
Cholangiocarcinoma	DIS71F6X	moderate	Genetic Variation	[30]
Methicillin-resistant staphylococci infection	DIS6DRDZ	moderate	Biomarker	[31]
Pulmonary emphysema	DIS5M7HZ	moderate	Biomarker	[30]
Neoplasm	DISZKGEW	Disputed	Biomarker	[32]
Amyotrophic lateral sclerosis	DISF7HVM	Limited	Biomarker	[33]
Chronic obstructive pulmonary disease	DISQCIRF	Limited	Biomarker	[34]
Colitis	DISAF7DD	Limited	Biomarker	[35]
Colorectal carcinoma	DIS5PYL0	Limited	Genetic Variation	[36]
Pancreatitis	DIS0IJEF	Limited	Altered Expression	[22]
Psychotic disorder	DIS4UQOT	Limited	Biomarker	[37]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of 28 kDa heat- and acid-stable phosphoprotein (PDAP1).	[38]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of 28 kDa heat- and acid-stable phosphoprotein (PDAP1).	[39]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of 28 kDa heat- and acid-stable phosphoprotein (PDAP1).	[40]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of 28 kDa heat- and acid-stable phosphoprotein (PDAP1).	[41]
Rifampicin	DM5DSFZ	Approved	Rifampicin decreases the expression of 28 kDa heat- and acid-stable phosphoprotein (PDAP1).	[42]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of 28 kDa heat- and acid-stable phosphoprotein (PDAP1).	[44]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of 28 kDa heat- and acid-stable phosphoprotein (PDAP1).	[45]
Choline	DM5D9YK	Investigative	Choline affects the expression of 28 kDa heat- and acid-stable phosphoprotein (PDAP1).	[46]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of 28 kDa heat- and acid-stable phosphoprotein (PDAP1).	[43]

References

• [1] In vivo-generated thrombin and plasmin do not activate the complement system in baboons.Blood. 2017 Dec 14;130(24):2678-2681. doi: 10.1182/blood-2017-06-788216. Epub 2017 Oct 11.
• [2] Polysomnographic determinants of requirement for advanced positive pressure therapeutic options for obstructive sleep apnea.Sleep Breath. 2018 May;22(2):401-409. doi: 10.1007/s11325-017-1556-8. Epub 2017 Aug 18.
• [3] Treating sleep apnea in Parkinson's disease with C-PAP: feasibility concerns and effects on cognition and alertness.Sleep Med. 2017 May;33:114-118. doi: 10.1016/j.sleep.2017.01.009. Epub 2017 Jan 27.
• [4] The HIF-2alpha dependent induction of PAP and adenosine synthesis regulates glioblastoma stem cell function through the A2B adenosine receptor.Int J Biochem Cell Biol. 2014 Apr;49:8-16. doi: 10.1016/j.biocel.2014.01.007. Epub 2014 Jan 13.
• [5] Human papillomavirus (HPV) test and PAP smear as predictors of outcome in conservatively treated adenocarcinoma in situ (AIS) of the uterine cervix.Gynecol Oncol. 2007 Jul;106(1):170-6. doi: 10.1016/j.ygyno.2007.03.016. Epub 2007 May 4.
• [6] Improvement in Sleep-Disordered Breathing Indices Downloaded From a Positive Airway Pressure Machine Following Conversion of Atrial Fibrillation to Sinus Rhythm.J Clin Sleep Med. 2018 Nov 15;14(11):1953-1957. doi: 10.5664/jcsm.7502.
• [7] Facilitating physical activity and reducing symptoms in patients with knee osteoarthritis: study protocol of a randomized controlled trial to test a theory-based PrevOP-psychological adherence program (PrevOP-PAP).BMC Musculoskelet Disord. 2018 Jul 18;19(1):221. doi: 10.1186/s12891-018-2158-8.
• [8] Detection of human papillomavirus DNA by the hybrid capture assay.Braz J Infect Dis. 2003 Apr;7(2):121-5. doi: 10.1590/s1413-86702003000200004. Epub 2003 Nov 19.
• [9] Early diagnosis behavior in Turkish women with and without a family history of cervical cancer.Asian Pac J Cancer Prev. 2015;16(2):401-6. doi: 10.7314/apjcp.2015.16.2.401.
• [10] Adherence to gynecological screening impacted by experienced orthodontic treatment in childhood.Arch Gynecol Obstet. 2019 Jan;299(1):167-171. doi: 10.1007/s00404-018-4950-y. Epub 2018 Oct 30.
• [11] Synergistic action of dual IGF1/R and MEK inhibition sensitizes childhood acute lymphoblastic leukemia (ALL) cells to cytotoxic agents and involves downregulation of STAT6 and PDAP1.Exp Hematol. 2018 Jul;63:52-63.e5. doi: 10.1016/j.exphem.2018.04.002. Epub 2018 Apr 12.
• [12] Infrainguinal bypass surgery outcomes are worse in hemodialysis patients compared with patients with renal transplants.J Vasc Surg. 2019 Mar;69(3):850-856. doi: 10.1016/j.jvs.2018.05.252. Epub 2018 Dec 21.
• [13] Increased expression of platelet-derived growth factor associated protein-1 is associated with PDGF-B mediated glioma progression.Int J Biochem Cell Biol. 2016 Sep;78:194-205. doi: 10.1016/j.biocel.2016.07.016. Epub 2016 Jul 19.
• [14] Inhibition of hepatitis B virus replication by pokeweed antiviral protein in vitro.World J Gastroenterol. 2008 Mar 14;14(10):1592-7. doi: 10.3748/wjg.14.1592.
• [15] Prevalence of human papillomavirus infection in women in the Autonomous Region of Inner Mongolia: A population-based study of a Chinese ethnic minority.J Med Virol. 2018 Jan;90(1):148-156. doi: 10.1002/jmv.24888. Epub 2017 Oct 6.
• [16] Effective immunochemotherapy of human t(4;11) leukemia in mice with severe combined immunodeficiency (SCID) using B43 (anti-CD19)-pokeweed antiviral protein immunotoxin plus cyclophosphamide.Leukemia. 1993 Feb;7(2):290-7.
• [17] Three mammalian lipins act as phosphatidate phosphatases with distinct tissue expression patterns.J Biol Chem. 2007 Feb 9;282(6):3450-7. doi: 10.1074/jbc.M610745200. Epub 2006 Dec 7.
• [18] MiR-125b-2 Knockout in Testis Is Associated with Targeting to the PAP Gene, Mitochondrial Copy Number, and Impaired Sperm Quality.Int J Mol Sci. 2019 Jan 3;20(1):148. doi: 10.3390/ijms20010148.
• [19] Nerve Injury-Induced Neuronal PAP-I Maintains Neuropathic Pain by Activating Spinal Microglia.J Neurosci. 2020 Jan 8;40(2):297-310. doi: 10.1523/JNEUROSCI.1414-19.2019. Epub 2019 Nov 19.
• [20] Redundant roles of the phosphatidate phosphatase family in triacylglycerol synthesis in human adipocytes.Diabetologia. 2016 Sep;59(9):1985-94. doi: 10.1007/s00125-016-4018-0. Epub 2016 Jun 25.
• [21] Mutations in MKKS cause Bardet-Biedl syndrome.Nat Genet. 2000 Sep;26(1):15-6. doi: 10.1038/79116.
• [22] PAP/REG3A favors perineural invasion in pancreatic adenocarcinoma and serves as a prognostic marker.Cell Mol Life Sci. 2017 Nov;74(22):4231-4243. doi: 10.1007/s00018-017-2579-9. Epub 2017 Jun 27.
• [23] Treatment of OSA with CPAP Is Associated with Improvement in PTSD Symptoms among Veterans.J Clin Sleep Med. 2017 Jan 15;13(1):57-63. doi: 10.5664/jcsm.6388.
• [24] Detection of HPV and ras gene mutations in cervical smears from female genital lesions.Oncol Rep. 1998 Sep-Oct;5(5):1195-8. doi: 10.3892/or.5.5.1195.
• [25] Characterization of adhesion associated surface properties of uropathogenic Escherichia coli.Folia Microbiol (Praha). 1994;39(5):373-7. doi: 10.1007/BF02814441.
• [26] Changes in pulmonary exercise haemodynamics in scleroderma: a 4-year prospective study.Eur Respir J. 2017 Jul 13;50(1):1601708. doi: 10.1183/13993003.01708-2016. Print 2017 Jul.
• [27] Economic Assessment of 4 Approaches to the Diagnosis and Initial Treatment of Sleep Apnea.Respir Care. 2018 Jan;63(1):50-61. doi: 10.4187/respcare.05355. Epub 2017 Oct 24.
• [28] Evaluation of pulmonary artery pressure in patients with juvenile systemic lupus erythematosus (jSLE).Bosn J Basic Med Sci. 2018 Feb 20;18(1):66-71. doi: 10.17305/bjbms.2017.2178.
• [29] Suppression of cardiac phosphatidate phosphohydrolase 1 activity and lipin mRNA expression in Zucker diabetic fatty rats and humans with type 2 diabetes mellitus.Biochem Biophys Res Commun. 2009 Dec 4;390(1):165-70. doi: 10.1016/j.bbrc.2009.09.108. Epub 2009 Sep 30.
• [30] Role for interleukin-6 in COPD-related pulmonary hypertension.Chest. 2009 Sep;136(3):678-687. doi: 10.1378/chest.08-2420. Epub 2009 Apr 6.
• [31] Screening for Intermediately Vancomycin-Susceptible and Vancomycin-Heteroresistant Staphylococcus aureus by Use of Vancomycin-Supplemented Brain Heart Infusion Agar Biplates: Defining Growth Interpretation Criteria Based on Gold Standard Confirmation.J Clin Microbiol. 2015 Nov;53(11):3543-6. doi: 10.1128/JCM.01620-15. Epub 2015 Aug 26.
• [32] Detection of high-grade neoplasia in air-dried cervical PAP smears by a microRNA-based classifier.Oncol Rep. 2018 Mar;39(3):1099-1111. doi: 10.3892/or.2018.6214. Epub 2018 Jan 12.
• [33] Associative Increases in Amyotrophic Lateral Sclerosis Survival Duration With Non-invasive Ventilation Initiation and Usage Protocols.Front Neurol. 2018 Jul 12;9:578. doi: 10.3389/fneur.2018.00578. eCollection 2018.
• [34] The evaluation of cardiac functions according to chronic obstructive pulmonary disease groups.Aging Male. 2020 Jun;23(2):106-111. doi: 10.1080/13685538.2019.1606191. Epub 2019 Apr 30.
• [35] Oral delivery of pancreatitis-associated protein by Lactococcus lactis displays protective effects in dinitro-benzenesulfonic-acid-induced colitis model and is able to modulate the composition of the microbiota.Environ Microbiol. 2019 Nov;21(11):4020-4031. doi: 10.1111/1462-2920.14748. Epub 2019 Sep 10.
• [36] Death from early colorectal cancer is predicted by the presence of transcripts of the REG gene family.Br J Cancer. 2000 Jul;83(2):188-95. doi: 10.1054/bjoc.2000.1227.
• [37] Increased frequency of psychosis after second-generation antiepileptic drug administration in adults with focal epilepsy.Epilepsy Behav. 2019 Aug;97:138-143. doi: 10.1016/j.yebeh.2019.06.002. Epub 2019 Jun 25.
• [38] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [39] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [40] Elucidating progesterone effects in breast cancer: cross talk with PDGF signaling pathway in smooth muscle cell. J Cell Biochem. 2007 Jan 1;100(1):174-83. doi: 10.1002/jcb.21045.
• [41] Cellular response to 5-fluorouracil (5-FU) in 5-FU-resistant colon cancer cell lines during treatment and recovery. Mol Cancer. 2006 May 18;5:20. doi: 10.1186/1476-4598-5-20.
• [42] Integrated analysis of rifampicin-induced microRNA and gene expression changes in human hepatocytes. Drug Metab Pharmacokinet. 2014;29(4):333-40.
• [43] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [44] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [45] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [46] Lymphocyte gene expression in subjects fed a low-choline diet differs between those who develop organ dysfunction and those who do not. Am J Clin Nutr. 2007 Jul;86(1):230-9. doi: 10.1093/ajcn/86.1.230.