Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTK7ELJ0)

• DOT Name: POU domain, class 2, transcription factor 1 (POU2F1)
• Synonyms: NF-A1; Octamer-binding protein 1; Oct-1; Octamer-binding transcription factor 1; OTF-1
• Gene Name: POU2F1
• Related Disease:
  Acute myelogenous leukaemia
  Gastric neoplasm
  Non-small-cell lung cancer
  Adult glioblastoma
  Advanced cancer
  Alzheimer disease
  Arteriosclerosis
  Atherosclerosis
  Bone osteosarcoma
  Breast cancer
  Breast carcinoma
  Carcinoma
  Carcinoma of esophagus
  Cervical cancer
  Cervical carcinoma
  Chronic kidney disease
  Colon cancer
  Colon carcinoma
  Epilepsy
  Esophageal cancer
  Gastric cancer
  Glioblastoma multiforme
  Head and neck carcinoma
  Hepatitis B virus infection
  Hepatitis C virus infection
  Hepatocellular carcinoma
  Inflammatory bowel disease
  leukaemia
  Leukemia
  Melanoma
  Neoplasm
  Neoplasm of esophagus
  Osteosarcoma
  Parkinson disease
  Primary biliary cholangitis
  Prostate neoplasm
  Squamous cell carcinoma
  Stomach cancer
  Autoimmune disease
  Prostate cancer
  Prostate carcinoma
  B-cell neoplasm
  Carcinoma of liver and intrahepatic biliary tract
  Liver cancer
  Metastatic malignant neoplasm
  Non-insulin dependent diabetes
  Rheumatoid arthritis
  Type-1/2 diabetes
• UniProt ID: PO2F1_HUMAN
• PDB ID: 1CQT; 1E3O; 1GT0; 1HF0; 1O4X; 1OCT; 1POG; 1POU
• Pfam ID: PF00046 ; PF00157 ; PF19536
• Sequence:
  MNNPSETSKPSMESGDGNTGTQTNGLDFQKQPVPVGGAISTAQAQAFLGHLHQVQLAGTS
  LQAAAQSLNVQSKSNEESGDSQQPSQPSQQPSVQAAIPQTQLMLAGGQITGLTLTPAQQQ
  LLLQQAQAQAQLLAAAVQQHSASQQHSAAGATISASAATPMTQIPLSQPIQIAQDLQQLQ
  QLQQQNLNLQQFVLVHPTTNLQPAQFIISQTPQGQQGLLQAQNLLTQLPQQSQANLLQSQ
  PSITLTSQPATPTRTIAATPIQTLPQSQSTPKRIDTPSLEEPSDLEELEQFAKTFKQRRI
  KLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAENLSSDS
  SLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEK
  EVIRVWFCNRRQKEKRINPPSSGGTSSSPIKAIFPSPTSLVATTPSLVTSSAATTLTVSP
  VLPLTSAAVTNLSVTGTSDTTSNNTATVISTAPPASSAVTSPSLSPSPSASASTSEASSA
  SETSTTQTTSTPLSSPLGTSQVMVTASGLQTAAAAALQGAAQLPANASLAAMAAAAGLNP
  SLMAPSQFAAGGALLSLNPGTLSGALSPALMSNSTLATIQALASGGSLPITSLDATGNLV
  FANAGGAPNIVTAPLFLNPQNLSLLTSNPVSLVSAAAASAGNSAPVASLHATSTSAESIQ
  NSLFTVASASGAASTTTTASKAQ
• Function: Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3') and activates the promoters of the genes for some small nuclear RNAs (snRNA) and of genes such as those for histone H2B and immunoglobulins. Modulates transcription transactivation by NR3C1, AR and PGR; (Microbial infection) In case of human herpes simplex virus (HSV) infection, POU2F1 forms a multiprotein-DNA complex with the viral transactivator protein VP16 and HCFC1 thereby enabling the transcription of the viral immediate early genes.
• Tissue Specificity: Ubiquitous. Isoform 2 is lymphocyte-specific.
• KEGG Pathway:
  Herpes simplex virus 1 infection (hsa05168)
  Lipid and atherosclerosis (hsa05417)
• Reactome Pathway:
  RNA polymerase II transcribes snRNA genes (R-HSA-6807505)
  RNA Polymerase III Abortive And Retractive Initiation (R-HSA-749476)
  RNA Polymerase III Transcription Initiation From Type 3 Promoter (R-HSA-76071)
  Estrogen-dependent gene expression (R-HSA-9018519)
  Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807)

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute myelogenous leukaemia	DISCSPTN	Definitive	Biomarker	[1]
Gastric neoplasm	DISOKN4Y	Definitive	Altered Expression	[2]
Non-small-cell lung cancer	DIS5Y6R9	Definitive	Altered Expression	[3]
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[4]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[5]
Alzheimer disease	DISF8S70	Strong	Biomarker	[6]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[7]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[7]
Bone osteosarcoma	DIST1004	Strong	Biomarker	[8]
Breast cancer	DIS7DPX1	Strong	Biomarker	[9]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[9]
Carcinoma	DISH9F1N	Strong	Biomarker	[10]
Carcinoma of esophagus	DISS6G4D	Strong	Posttranslational Modification	[11]
Cervical cancer	DISFSHPF	Strong	Altered Expression	[12]
Cervical carcinoma	DIST4S00	Strong	Altered Expression	[12]
Chronic kidney disease	DISW82R7	Strong	Genetic Variation	[13]
Colon cancer	DISVC52G	Strong	Genetic Variation	[14]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[14]
Epilepsy	DISBB28L	Strong	Genetic Variation	[15]
Esophageal cancer	DISGB2VN	Strong	Posttranslational Modification	[11]
Gastric cancer	DISXGOUK	Strong	Biomarker	[5]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[4]
Head and neck carcinoma	DISOU1DS	Strong	Altered Expression	[16]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[17]
Hepatitis C virus infection	DISQ0M8R	Strong	Biomarker	[17]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[18]
Inflammatory bowel disease	DISGN23E	Strong	Genetic Variation	[19]
leukaemia	DISS7D1V	Strong	Biomarker	[1]
Leukemia	DISNAKFL	Strong	Biomarker	[1]
Melanoma	DIS1RRCY	Strong	Biomarker	[20]
Neoplasm	DISZKGEW	Strong	Biomarker	[14]
Neoplasm of esophagus	DISOLKAQ	Strong	Posttranslational Modification	[11]
Osteosarcoma	DISLQ7E2	Strong	Biomarker	[8]
Parkinson disease	DISQVHKL	Strong	Genetic Variation	[21]
Primary biliary cholangitis	DIS43E0O	Strong	Genetic Variation	[22]
Prostate neoplasm	DISHDKGQ	Strong	Altered Expression	[23]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[24]
Stomach cancer	DISKIJSX	Strong	Biomarker	[5]
Autoimmune disease	DISORMTM	moderate	Biomarker	[25]
Prostate cancer	DISF190Y	Disputed	Altered Expression	[26]
Prostate carcinoma	DISMJPLE	Disputed	Altered Expression	[26]
B-cell neoplasm	DISVY326	Limited	Biomarker	[27]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Limited	Altered Expression	[28]
Liver cancer	DISDE4BI	Limited	Altered Expression	[28]
Metastatic malignant neoplasm	DIS86UK6	Limited	Altered Expression	[29]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Genetic Variation	[30]
Rheumatoid arthritis	DISTSB4J	Limited	Altered Expression	[31]
Type-1/2 diabetes	DISIUHAP	Limited	Genetic Variation	[32]

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of POU domain, class 2, transcription factor 1 (POU2F1).	[33]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of POU domain, class 2, transcription factor 1 (POU2F1).	[34]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of POU domain, class 2, transcription factor 1 (POU2F1).	[35]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of POU domain, class 2, transcription factor 1 (POU2F1).	[36]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of POU domain, class 2, transcription factor 1 (POU2F1).	[37]
Phenobarbital	DMXZOCG	Approved	Phenobarbital decreases the expression of POU domain, class 2, transcription factor 1 (POU2F1).	[38]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of POU domain, class 2, transcription factor 1 (POU2F1).	[39]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of POU domain, class 2, transcription factor 1 (POU2F1).	[37]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of POU domain, class 2, transcription factor 1 (POU2F1).	[40]
Rifampicin	DM5DSFZ	Approved	Rifampicin decreases the expression of POU domain, class 2, transcription factor 1 (POU2F1).	[38]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of POU domain, class 2, transcription factor 1 (POU2F1).	[40]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of POU domain, class 2, transcription factor 1 (POU2F1).	[42]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of POU domain, class 2, transcription factor 1 (POU2F1).	[43]
GALLICACID	DM6Y3A0	Investigative	GALLICACID decreases the expression of POU domain, class 2, transcription factor 1 (POU2F1).	[44]
crotylaldehyde	DMTWRQI	Investigative	crotylaldehyde decreases the expression of POU domain, class 2, transcription factor 1 (POU2F1).	[45]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of POU domain, class 2, transcription factor 1 (POU2F1).	[41]

References

• [1] Transcription factor Oct1 protects against hematopoietic stress and promotes acute myeloid leukemia.Exp Hematol. 2019 Aug;76:38-48.e2. doi: 10.1016/j.exphem.2019.07.002. Epub 2019 Jul 8.
• [2] Conserved POU-binding site linked to SP1-binding site within FZD5 promoter: Transcriptional mechanisms of FZD5 in undifferentiated human ES cells, fetal liver/spleen, adult colon, pancreatic islet, and diffuse-type gastric cancer.Int J Oncol. 2007 Mar;30(3):751-5.
• [3] Oct-1 DNA binding activity unresponsive to retinoblastoma protein expression prevents MHC class II induction in a non-small cell lung carcinoma cell line.Mol Immunol. 2006 Feb;43(6):710-6. doi: 10.1016/j.molimm.2005.03.013. Epub 2005 Apr 14.
• [4] In vivo footprint analysis of the HLA-DRA gene promoter: cell-specific interaction at the octamer site and up-regulation of X box binding by interferon gamma.Proc Natl Acad Sci U S A. 1992 Aug 15;89(16):7601-5. doi: 10.1073/pnas.89.16.7601.
• [5] DLX6-AS1/miR-204-5p/OCT1 positive feedback loop promotes tumor progression and epithelial-mesenchymal transition in gastric cancer.Gastric Cancer. 2020 Mar;23(2):212-227. doi: 10.1007/s10120-019-01002-1. Epub 2019 Aug 28.
• [6] Interactions between the products of the Herpes simplex genome and Alzheimer's disease susceptibility genes: relevance to pathological-signalling cascades.Neurochem Int. 2008 May;52(6):920-34. doi: 10.1016/j.neuint.2007.11.003. Epub 2007 Nov 23.
• [7] Lectin-like oxidized low-density lipoprotein receptor-1 (LOX-1) transcriptional regulation by Oct-1 in human endothelial cells: implications for atherosclerosis.Biochem J. 2006 Jan 1;393(Pt 1):255-65. doi: 10.1042/BJ20050845.
• [8] LncRNA SND1-IT1 accelerates the proliferation and migration of osteosarcoma via sponging miRNA-665 to upregulate POU2F1.Eur Rev Med Pharmacol Sci. 2019 Nov;23(22):9772-9780. doi: 10.26355/eurrev_201911_19540.
• [9] ATF-2 controls transcription of Maspin and GADD45 alpha genes independently from p53 to suppress mammary tumors.Oncogene. 2008 Feb 14;27(8):1045-54. doi: 10.1038/sj.onc.1210727. Epub 2007 Aug 13.
• [10] OCT-1 is over-expressed in intestinal metaplasia and intestinal gastric carcinomas and binds to, but does not transactivate, CDX2 in gastric cells.J Pathol. 2005 Dec;207(4):396-401. doi: 10.1002/path.1861.
• [11] Long-term cisplatin exposure promotes methylation of the OCT1 gene in human esophageal cancer cells. Dig Dis Sci. 2013 Mar;58(3):694-8.
• [12] E6/E7-P53-POU2F1-CTHRC1 axis promotes cervical cancer metastasis and activates Wnt/PCP pathway.Sci Rep. 2017 Mar 17;7:44744. doi: 10.1038/srep44744.
• [13] Vitamin D-regulated osteocytic sclerostin and BMP2 modulate uremic extraskeletal calcification.JCI Insight. 2019 Jul 11;4(13):e126467. doi: 10.1172/jci.insight.126467. eCollection 2019 Jul 11.
• [14] Oct1/Pou2f1 is selectively required for colon regeneration and regulates colon malignancy.PLoS Genet. 2019 May 6;15(5):e1007687. doi: 10.1371/journal.pgen.1007687. eCollection 2019 May.
• [15] Specific OCT1 and ABCG2 polymorphisms are associated with Lamotrigine concentrations in Chinese patients with epilepsy. Epilepsy Res. 2016 Nov;127:186-190.
• [16] POU2F1 activity regulates HOXD10 and HOXD11 promoting a proliferative and invasive phenotype in head and neck cancer.Oncotarget. 2014 Sep 30;5(18):8803-15. doi: 10.18632/oncotarget.2492.
• [17] Hepatitis B virus reactivation during direct-acting antiviral therapy for hepatitis C: a systematic review and meta-analysis.Lancet Gastroenterol Hepatol. 2018 Mar;3(3):172-180. doi: 10.1016/S2468-1253(18)30002-5. Epub 2018 Jan 19.
• [18] Sorafenib Activity and Disposition in Liver Cancer Does Not Depend on Organic Cation Transporter 1.Clin Pharmacol Ther. 2020 Jan;107(1):227-237. doi: 10.1002/cpt.1588. Epub 2019 Sep 3.
• [19] Inflammatory bowel disease is associated with a TNF polymorphism that affects an interaction between the OCT1 and NF(-kappa)B transcription factors.Hum Mol Genet. 2002 May 15;11(11):1281-9. doi: 10.1093/hmg/11.11.1281.
• [20] A distinct octamer-binding protein present in malignant melanoma cells.Nucleic Acids Res. 1988 Dec 9;16(23):11047-56. doi: 10.1093/nar/16.23.11047.
• [21] Identification of novel risk loci, causal insights, and heritable risk for Parkinson's disease: a meta-analysis of genome-wide association studies.Lancet Neurol. 2019 Dec;18(12):1091-1102. doi: 10.1016/S1474-4422(19)30320-5.
• [22] Pathophysiological analysis of primary biliary cirrhosis focusing on choline/phospholipid metabolism.Liver Int. 2015 Mar;35(3):1095-102. doi: 10.1111/liv.12526. Epub 2014 Mar 31.
• [23] TET2 binds the androgen receptor and loss is associated with prostate cancer.Oncogene. 2017 Apr;36(15):2172-2183. doi: 10.1038/onc.2016.376. Epub 2016 Nov 7.
• [24] Ionizing radiation stimulates octamer factor DNA binding activity in human carcinoma cells.Mol Cell Biochem. 1999 Sep;199(1-2):209-15. doi: 10.1023/a:1006958217143.
• [25] T cell-selective deletion of Oct1 protects animals from autoimmune neuroinflammation while maintaining neurotropic pathogen response.J Neuroinflammation. 2019 Jul 3;16(1):133. doi: 10.1186/s12974-019-1523-3.
• [26] Targeting Oct1 genomic function inhibits androgen receptor signaling and castration-resistant prostate cancer growth.Oncogene. 2016 Dec 8;35(49):6350-6358. doi: 10.1038/onc.2016.171. Epub 2016 Jun 6.
• [27] Primary brain tumors differ in their expression of octamer deoxyribonucleic acid-binding transcription factors from long-term cultured glioma cell lines.Neurosurgery. 1994 Jan;34(1):129-35.
• [28] miR-449a promotes liver cancer cell apoptosis by downregulation of Calpain 6 and POU2F1.Oncotarget. 2016 Mar 22;7(12):13491-501. doi: 10.18632/oncotarget.4821.
• [29] Significance of OCT1 Expression in Acute Myeloid Leukemia.Pathol Oncol Res. 2017 Jul;23(3):665-671. doi: 10.1007/s12253-016-0161-7. Epub 2016 Dec 26.
• [30] The role of clinical response to metformin in patients newly diagnosed with type 2 diabetes: a monotherapy study.Clin Exp Med. 2015 May;15(2):159-65. doi: 10.1007/s10238-014-0283-8. Epub 2014 Apr 17.
• [31] Involvement of simultaneous multiple transcription factor expression, including cAMP responsive element binding protein and OCT-1, for synovial cell outgrowth in patients with rheumatoid arthritis.Ann Rheum Dis. 1998 Aug;57(8):487-94. doi: 10.1136/ard.57.8.487.
• [32] Genetic variants of OCT1 influence glycemic response to metformin in Han Chinese patients with type-2 diabetes mellitus in Shanghai.Int J Clin Exp Pathol. 2015 Aug 1;8(8):9533-42. eCollection 2015.
• [33] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [34] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [35] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [36] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [37] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [38] Differential regulation of sinusoidal and canalicular hepatic drug transporter expression by xenobiotics activating drug-sensing receptors in primary human hepatocytes. Drug Metab Dispos. 2006 Oct;34(10):1756-63. doi: 10.1124/dmd.106.010033. Epub 2006 Jul 12.
• [39] The use of genomics technology to investigate gene expression changes in cultured human liver cells. Toxicol In Vitro. 2001 Aug-Oct;15(4-5):399-405. doi: 10.1016/s0887-2333(01)00043-1.
• [40] Effects of tobacco compounds on gene expression in fetal lung fibroblasts. Environ Toxicol. 2008 Aug;23(4):423-34.
• [41] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [42] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [43] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [44] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.
• [45] Gene expression profile and cytotoxicity of human bronchial epithelial cells exposed to crotonaldehyde. Toxicol Lett. 2010 Aug 16;197(2):113-22.