General Information of Drug Off-Target (DOT) (ID: OTLLZERL)

DOT Name E3 ubiquitin ligase TRAF3IP2 (TRAF3IP2)
Synonyms EC 2.3.2.27; Adapter protein CIKS; Connection to IKK and SAPK/JNK; E3 ubiquitin-protein ligase CIKS; Nuclear factor NF-kappa-B activator 1; ACT1; TRAF3-interacting protein 2
Gene Name TRAF3IP2
Related Disease
Neoplasm ( )
Acute myocardial infarction ( )
Advanced cancer ( )
Atopic dermatitis ( )
Autoimmune disease ( )
Behcet disease ( )
Candidiasis, familial, 8 ( )
Capillary malformation ( )
Cardiovascular disease ( )
Cluster headache ( )
Colonic disorder ( )
Dermatitis ( )
Glioma ( )
Hirschsprung disease ( )
Inflammatory bowel disease ( )
Irritable bowel syndrome ( )
Malaria ( )
Myocardial infarction ( )
Nasal polyp ( )
Palmoplantar pustulosis ( )
Pneumonia ( )
Pneumonitis ( )
Polyp ( )
Psoriasis ( )
Pyoderma gangrenosum ( )
Rheumatoid arthritis ( )
Schwartz-Jampel syndrome ( )
Sjogren syndrome ( )
Systemic lupus erythematosus ( )
Thyroid gland undifferentiated (anaplastic) carcinoma ( )
Toxic epidermal necrolysis ( )
Ulcerative colitis ( )
Vascular disease ( )
Mycetoma ( )
Myocardial ischemia ( )
Chronic mucocutaneous candidiasis ( )
Arteriosclerosis ( )
Atherosclerosis ( )
Bronchiectasis ( )
Crohn disease ( )
Glioblastoma multiforme ( )
Headache ( )
Migraine disorder ( )
Oral candidiasis ( )
Psoriatic arthritis ( )
Type-1/2 diabetes ( )
UniProt ID
CIKS_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
2.3.2.27
Pfam ID
PF08357
Sequence
MPPQLQETRMNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPT
MLHNSSGDFSQAHSTLKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHPGLGKAFPSGCS
AVSEPASESVVGALPAEHQFSFMEKRNQWLVSQLSAASPDTGHDSDKSDQSLPNASADSL
GGSQEMVQRPQPHRNRAGLDLPTIDTGYDSQPQDVLGIRQLERPLPLTSVCYPQDLPRPL
RSREFPQFEPQRYPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPRAAYQQVIQ
PALPGQPLPGASVRGLHPVQKVILNYPSPWDHEERPAQRDCSFPGLPRHQDQPHHQPPNR
AGAPGESLECPAELRPQVPQPPSPAAVPRPPSNPPARGTLKTSNLPEELRKVFITYSMDT
AMEVVKFVNFLLVNGFQTAIDIFEDRIRGIDIIKWMERYLRDKTVMIIVAISPKYKQDVE
GAESQLDEDEHGLHTKYIHRMMQIEFIKQGSMNFRFIPVLFPNAKKEHVPTWLQNTHVYS
WPKNKKNILLRLLREEEYVAPPRGPLPTLQVVPL
Function
E3 ubiquitin ligase that catalyzes 'Lys-63'-linked polyubiquitination of target protein, enhancing protein-protein interaction and cell signaling. Transfers ubiquitin from E2 ubiquitin-conjugating enzyme UBE2V1-UBE2N to substrate protein. Essential adapter molecule in IL17A-mediated signaling. Upon IL17A stimulation, interacts with IL17RA and IL17RC receptor chains through SEFIR domains and catalyzes 'Lys-63'-linked polyubiquitination of TRAF6, leading to TRAF6-mediated activation of NF-kappa-B and MAPkinase pathways.
Tissue Specificity Widely expressed.
KEGG Pathway
Cellular senescence (hsa04218 )
IL-17 sig.ling pathway (hsa04657 )

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Neoplasm DISZKGEW Definitive Biomarker [1]
Acute myocardial infarction DISE3HTG Strong Biomarker [2]
Advanced cancer DISAT1Z9 Strong Biomarker [3]
Atopic dermatitis DISTCP41 Strong Biomarker [4]
Autoimmune disease DISORMTM Strong Genetic Variation [5]
Behcet disease DISSYMBS Strong Genetic Variation [6]
Candidiasis, familial, 8 DISMCSDG Strong Autosomal recessive [7]
Capillary malformation DISR6ZSG Strong Genetic Variation [8]
Cardiovascular disease DIS2IQDX Strong Genetic Variation [9]
Cluster headache DISKAXY9 Strong Biomarker [10]
Colonic disorder DISXXS3L Strong Genetic Variation [11]
Dermatitis DISY5SZC Strong Genetic Variation [12]
Glioma DIS5RPEH Strong Biomarker [3]
Hirschsprung disease DISUUSM1 Strong Altered Expression [13]
Inflammatory bowel disease DISGN23E Strong Genetic Variation [14]
Irritable bowel syndrome DIS27206 Strong Genetic Variation [15]
Malaria DISQ9Y50 Strong Biomarker [16]
Myocardial infarction DIS655KI Strong Genetic Variation [9]
Nasal polyp DISLP3XE Strong Biomarker [17]
Palmoplantar pustulosis DISCNSWD Strong Biomarker [18]
Pneumonia DIS8EF3M Strong Biomarker [19]
Pneumonitis DIS88E0K Strong Biomarker [19]
Polyp DISRSLYF Strong Altered Expression [17]
Psoriasis DIS59VMN Strong Genetic Variation [20]
Pyoderma gangrenosum DIS8QVTT Strong Genetic Variation [15]
Rheumatoid arthritis DISTSB4J Strong Biomarker [21]
Schwartz-Jampel syndrome DIS3HCR8 Strong Genetic Variation [22]
Sjogren syndrome DISUBX7H Strong Genetic Variation [23]
Systemic lupus erythematosus DISI1SZ7 Strong Biomarker [24]
Thyroid gland undifferentiated (anaplastic) carcinoma DISYBB1W Strong Biomarker [25]
Toxic epidermal necrolysis DISIWPFR Strong Genetic Variation [22]
Ulcerative colitis DIS8K27O Strong Genetic Variation [26]
Vascular disease DISVS67S Strong Biomarker [27]
Mycetoma DIST5UFZ moderate Biomarker [28]
Myocardial ischemia DISFTVXF moderate Biomarker [29]
Chronic mucocutaneous candidiasis DISPSGYF Supportive Autosomal dominant [30]
Arteriosclerosis DISK5QGC Limited Biomarker [31]
Atherosclerosis DISMN9J3 Limited Biomarker [31]
Bronchiectasis DIS5MYEE Limited Genetic Variation [8]
Crohn disease DIS2C5Q8 Limited Biomarker [32]
Glioblastoma multiforme DISK8246 Limited Altered Expression [33]
Headache DISK4TGU Limited Biomarker [34]
Migraine disorder DISFCQTG Limited Biomarker [34]
Oral candidiasis DISAVKAH Limited Genetic Variation [8]
Psoriatic arthritis DISLWTG2 Limited Genetic Variation [35]
Type-1/2 diabetes DISIUHAP Limited Biomarker [31]
------------------------------------------------------------------------------------
⏷ Show the Full List of 46 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of E3 ubiquitin ligase TRAF3IP2 (TRAF3IP2). [36]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of E3 ubiquitin ligase TRAF3IP2 (TRAF3IP2). [45]
------------------------------------------------------------------------------------
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of E3 ubiquitin ligase TRAF3IP2 (TRAF3IP2). [37]
Tretinoin DM49DUI Approved Tretinoin increases the expression of E3 ubiquitin ligase TRAF3IP2 (TRAF3IP2). [38]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of E3 ubiquitin ligase TRAF3IP2 (TRAF3IP2). [39]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of E3 ubiquitin ligase TRAF3IP2 (TRAF3IP2). [40]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of E3 ubiquitin ligase TRAF3IP2 (TRAF3IP2). [41]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of E3 ubiquitin ligase TRAF3IP2 (TRAF3IP2). [42]
Decitabine DMQL8XJ Approved Decitabine affects the expression of E3 ubiquitin ligase TRAF3IP2 (TRAF3IP2). [43]
Menadione DMSJDTY Approved Menadione affects the expression of E3 ubiquitin ligase TRAF3IP2 (TRAF3IP2). [44]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of E3 ubiquitin ligase TRAF3IP2 (TRAF3IP2). [46]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)

References

1 IL-17R-EGFR axis links wound healing to tumorigenesis in Lrig1(+) stem cells.J Exp Med. 2019 Jan 7;216(1):195-214. doi: 10.1084/jem.20171849. Epub 2018 Dec 21.
2 microRNA-340-5p inhibits hypoxia/reoxygenation-induced apoptosis and oxidative stress in cardiomyocytes by regulating the Act1/NF-B pathway.J Cell Biochem. 2019 Sep;120(9):14618-14627. doi: 10.1002/jcb.28723. Epub 2019 Apr 15.
3 Anti-inflammatory Effects of Atorvastatin in Human Glioblastoma Spheroids Cultured in a Three-dimensional Model: Possible Relevance to Glioblastoma Treatment.Mol Neurobiol. 2018 Mar;55(3):2102-2110. doi: 10.1007/s12035-017-0445-2. Epub 2017 Mar 10.
4 An atopic dermatitis-like skin disease with hyper-IgE-emia develops in mice carrying a spontaneous recessive point mutation in the Traf3ip2 (Act1/CIKS) gene.J Immunol. 2010 Aug 15;185(4):2340-9. doi: 10.4049/jimmunol.0900694. Epub 2010 Jul 21.
5 Neutrophil Extracellular Traps Induce HumanTh17 Cells: Effect of Psoriasis-Associated TRAF3IP2 Genotype.J Invest Dermatol. 2019 Jun;139(6):1245-1253. doi: 10.1016/j.jid.2018.11.021. Epub 2018 Dec 5.
6 TRAF5 and TRAF3IP2 gene polymorphisms are associated with Behet's disease and Vogt-Koyanagi-Harada syndrome: a case-control study.PLoS One. 2014 Jan 8;9(1):e84214. doi: 10.1371/journal.pone.0084214. eCollection 2014.
7 Deficiency of Act1, a critical modulator of B cell function, leads to development of Sj?gren's syndrome. Eur J Immunol. 2008 Aug;38(8):2219-28. doi: 10.1002/eji.200738113.
8 Chronic Mucocutaneous Candidiasis in an Adolescent Boy Due to a Novel Mutation in TRAF3IP2.J Clin Immunol. 2019 Aug;39(6):596-599. doi: 10.1007/s10875-019-00664-x. Epub 2019 Jul 10.
9 Plasma CXCL1 levels and TRAF3IP2 variants in patients with myocardial infarction.J Clin Lab Anal. 2018 Jul;32(6):e22402. doi: 10.1002/jcla.22402. Epub 2018 Feb 12.
10 Differential efficacy of non-invasive vagus nerve stimulation for the acute treatment of episodic and chronic cluster headache: A meta-analysis.Cephalalgia. 2019 Jul;39(8):967-977. doi: 10.1177/0333102419856607. Epub 2019 Jun 10.
11 Perianal Crohn's Disease is Associated with Distal Colonic Disease, Stricturing Disease Behavior, IBD-Associated Serologies and Genetic Variation in the JAK-STAT Pathway.Inflamm Bowel Dis. 2016 Apr;22(4):862-9. doi: 10.1097/MIB.0000000000000705.
12 The psoriasis-associated D10N variant of the adaptor Act1 with impaired regulation by the molecular chaperone hsp90.Nat Immunol. 2013 Jan;14(1):72-81. doi: 10.1038/ni.2479. Epub 2012 Dec 2.
13 Increased Act1/IL-17R expression in Hirschsprung's disease.Pediatr Surg Int. 2016 Dec;32(12):1201-1207. doi: 10.1007/s00383-016-3980-4. Epub 2016 Sep 22.
14 Impact of Obesity on Short- and Intermediate-Term Outcomes in Inflammatory Bowel Diseases: Pooled Analysis of Placebo Arms of Infliximab Clinical Trials.Inflamm Bowel Dis. 2018 Sep 15;24(10):2278-2284. doi: 10.1093/ibd/izy135.
15 TRAF3IP2 gene is associated with cutaneous extraintestinal manifestations in inflammatory bowel disease.J Crohns Colitis. 2013 Feb;7(1):44-52. doi: 10.1016/j.crohns.2012.02.020. Epub 2012 Mar 24.
16 Unusual dynamics of the divergent malaria parasite PfAct1 actin filament.Proc Natl Acad Sci U S A. 2019 Oct 8;116(41):20418-20427. doi: 10.1073/pnas.1906600116. Epub 2019 Sep 23.
17 Interleukin-17A promotes MUC5AC expression and goblet cell hyperplasia in nasal polyps via the Act1-mediated pathway.PLoS One. 2014 Jun 3;9(6):e98915. doi: 10.1371/journal.pone.0098915. eCollection 2014.
18 Common variants at TRAF3IP2 are associated with susceptibility to psoriatic arthritis and psoriasis.Nat Genet. 2010 Nov;42(11):996-9. doi: 10.1038/ng.688. Epub 2010 Oct 17.
19 The critical role of epithelial-derived Act1 in IL-17- and IL-25-mediated pulmonary inflammation.J Immunol. 2009 Feb 1;182(3):1631-40. doi: 10.4049/jimmunol.182.3.1631.
20 The Act1 D10N missense variant impairs CD40 signaling in human B-cells.Genes Immun. 2019 Jan;20(1):23-31. doi: 10.1038/s41435-017-0007-7. Epub 2018 Jan 5.
21 Polymorphisms in STAT4, PTPN2, PSORS1C1 and TRAF3IP2 Genes Are Associated with the Response to TNF Inhibitors in Patients with Rheumatoid Arthritis.PLoS One. 2017 Jan 20;12(1):e0169956. doi: 10.1371/journal.pone.0169956. eCollection 2017.
22 A pharmacogenetics study in Mozambican patients treated with nevirapine: full resequencing of TRAF3IP2 gene shows a novel association with SJS/TEN susceptibility.Int J Mol Sci. 2015 Mar 12;16(3):5830-8. doi: 10.3390/ijms16035830.
23 Act1 is a negative regulator in T and B cells via direct inhibition of STAT3.Nat Commun. 2018 Jul 16;9(1):2745. doi: 10.1038/s41467-018-04974-3.
24 TRAF3IP2 gene and systemic lupus erythematosus: association with disease susceptibility and pericarditis development.Immunogenetics. 2013 Oct;65(10):703-9. doi: 10.1007/s00251-013-0717-6. Epub 2013 Jul 9.
25 Coordinated expression of galectin-3 and caveolin-1 in thyroid cancer.J Pathol. 2012 Sep;228(1):56-66. doi: 10.1002/path.4041. Epub 2012 Jul 10.
26 No Benefit of Concomitant 5-Aminosalicylates in Patients With Ulcerative Colitis Escalated to Biologic Therapy: Pooled Analysis of Individual Participant Data From Clinical Trials.Am J Gastroenterol. 2018 Aug;113(8):1197-1205. doi: 10.1038/s41395-018-0144-2. Epub 2018 Jun 21.
27 TRAF3IP2 mediates high glucose-induced endothelin-1 production as well as endothelin-1-induced inflammation in endothelial cells.Am J Physiol Heart Circ Physiol. 2018 Jan 1;314(1):H52-H64. doi: 10.1152/ajpheart.00478.2017. Epub 2017 Sep 29.
28 Pleurostomophora ochracea, a novel agent of human eumycetoma with yellow grains.J Clin Microbiol. 2012 Sep;50(9):2987-94. doi: 10.1128/JCM.01470-12. Epub 2012 Jul 3.
29 Targeting TRAF3IP2 by Genetic and Interventional Approaches Inhibits Ischemia/Reperfusion-induced Myocardial Injury and Adverse Remodeling.J Biol Chem. 2017 Feb 10;292(6):2345-2358. doi: 10.1074/jbc.M116.764522. Epub 2017 Jan 4.
30 An ACT1 mutation selectively abolishes interleukin-17 responses in humans with chronic mucocutaneous candidiasis. Immunity. 2013 Oct 17;39(4):676-86. doi: 10.1016/j.immuni.2013.09.002. Epub 2013 Oct 10.
31 CIKS (Act1 or TRAF3IP2) mediates high glucose-induced endothelial dysfunction.Cell Signal. 2013 Jan;25(1):359-71. doi: 10.1016/j.cellsig.2012.10.009. Epub 2012 Oct 17.
32 Gender Differences and Other Factors Associated with Weight Gain Following Initiation of Infliximab: A Post Hoc Analysis of Clinical Trials.Inflamm Bowel Dis. 2020 Jan 1;26(1):125-131. doi: 10.1093/ibd/izz133.
33 TRAF3IP2, a novel therapeutic target in glioblastoma multiforme.Oncotarget. 2018 Jul 3;9(51):29772-29788. doi: 10.18632/oncotarget.25710. eCollection 2018 Jul 3.
34 Spotlight on cervical vagus nerve stimulation for the treatment of primary headache disorders: a review.J Pain Res. 2018 Aug 27;11:1613-1625. doi: 10.2147/JPR.S129202. eCollection 2018.
35 Genetic variation at the glycosaminoglycan metabolism pathway contributes to the risk of psoriatic arthritis but not psoriasis.Ann Rheum Dis. 2019 Mar;78(3):e214158. doi: 10.1136/annrheumdis-2018-214158. Epub 2018 Dec 14.
36 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
37 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
38 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
39 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
40 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
41 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
42 Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
43 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
44 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
45 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
46 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.