General Information of Drug Off-Target (DOT) (ID: OTME98V7)

DOT Name Latent-transforming growth factor beta-binding protein 3 (LTBP3)
Synonyms LTBP-3
Gene Name LTBP3
Related Disease
Brachyolmia-amelogenesis imperfecta syndrome ( )
Breast cancer ( )
Breast carcinoma ( )
Amelogenesis imperfecta ( )
Anxiety ( )
Anxiety disorder ( )
Autoimmune disease ( )
Bone disease ( )
Brachyolmia ( )
Cardiac disease ( )
Cardiac failure ( )
Cervical cancer ( )
Cervical carcinoma ( )
Colon cancer ( )
Colon carcinoma ( )
Congestive heart failure ( )
Depression ( )
Epilepsy ( )
Esophageal squamous cell carcinoma ( )
Geleophysic dysplasia 3 ( )
Glaucoma/ocular hypertension ( )
Head and neck cancer ( )
Head and neck carcinoma ( )
Hepatocellular carcinoma ( )
Major depressive disorder ( )
Melanoma ( )
Mental disorder ( )
Mitral valve prolapse ( )
Mood disorder ( )
Neoplasm ( )
Obsessive compulsive disorder ( )
Obstructive sleep apnea ( )
Osteoarthritis ( )
Plasma cell myeloma ( )
Post-traumatic stress disorder ( )
Advanced cancer ( )
Carcinoma ( )
Nasopharyngeal carcinoma ( )
Nervous system disease ( )
Obesity ( )
Squamous cell carcinoma ( )
Tooth agenesis ( )
Tooth agenesis, selective, 1 ( )
Acromicric dysplasia ( )
Geleophysic dysplasia ( )
Malignant mesothelioma ( )
Mesothelioma ( )
UniProt ID
LTBP3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF12662 ; PF07645 ; PF12661 ; PF00683
Sequence
MPGPRGAAGGLAPEMRGAGAAGLLALLLLLLLLLLGLGGRVEGGPAGERGAGGGGALARE
RFKVVFAPVICKRTCLKGQCRDSCQQGSNMTLIGENGHSTDTLTGSGFRVVVCPLPCMNG
GQCSSRNQCLCPPDFTGRFCQVPAGGAGGGTGGSGPGLSRTGALSTGALPPLAPEGDSVA
SKHAIYAVQVIADPPGPGEGPPAQHAAFLVPLGPGQISAEVQAPPPVVNVRVHHPPEASV
QVHRIESSNAESAAPSQHLLPHPKPSHPRPPTQKPLGRCFQDTLPKQPCGSNPLPGLTKQ
EDCCGSIGTAWGQSKCHKCPQLQYTGVQKPGPVRGEVGADCPQGYKRLNSTHCQDINECA
MPGVCRHGDCLNNPGSYRCVCPPGHSLGPSRTQCIADKPEEKSLCFRLVSPEHQCQHPLT
TRLTRQLCCCSVGKAWGARCQRCPTDGTAAFKEICPAGKGYHILTSHQTLTIQGESDFSL
FLHPDGPPKPQQLPESPSQAPPPEDTEEERGVTTDSPVSEERSVQQSHPTATTTPARPYP
ELISRPSPPTMRWFLPDLPPSRSAVEIAPTQVTETDECRLNQNICGHGECVPGPPDYSCH
CNPGYRSHPQHRYCVDVNECEAEPCGPGRGICMNTGGSYNCHCNRGYRLHVGAGGRSCVD
LNECAKPHLCGDGGFCINFPGHYKCNCYPGYRLKASRPPVCEDIDECRDPSSCPDGKCEN
KPGSFKCIACQPGYRSQGGGACRDVNECAEGSPCSPGWCENLPGSFRCTCAQGYAPAPDG
RSCLDVDECEAGDVCDNGICSNTPGSFQCQCLSGYHLSRDRSHCEDIDECDFPAACIGGD
CINTNGSYRCLCPQGHRLVGGRKCQDIDECSQDPSLCLPHGACKNLQGSYVCVCDEGFTP
TQDQHGCEEVEQPHHKKECYLNFDDTVFCDSVLATNVTQQECCCSLGAGWGDHCEIYPCP
VYSSAEFHSLCPDGKGYTQDNNIVNYGIPAHRDIDECMLFGSEICKEGKCVNTQPGYECY
CKQGFYYDGNLLECVDVDECLDESNCRNGVCENTRGGYRCACTPPAEYSPAQRQCLSPEE
MDVDECQDPAACRPGRCVNLPGSYRCECRPPWVPGPSGRDCQLPESPAERAPERRDVCWS
QRGEDGMCAGPLAGPALTFDDCCCRQGRGWGAQCRPCPPRGAGSHCPTSQSESNSFWDTS
PLLLGKPPRDEDSSEEDSDECRCVSGRCVPRPGGAVCECPGGFQLDASRARCVDIDECRE
LNQRGLLCKSERCVNTSGSFRCVCKAGFARSRPHGACVPQRRR
Function
Key regulator of transforming growth factor beta (TGFB1, TGFB2 and TGFB3) that controls TGF-beta activation by maintaining it in a latent state during storage in extracellular space. Associates specifically via disulfide bonds with the Latency-associated peptide (LAP), which is the regulatory chain of TGF-beta, and regulates integrin-dependent activation of TGF-beta.
Tissue Specificity Isoform 2: Expressed prominently in heart, skeletal muscle, prostate, testis, small intestine and ovary . Isoform 1: Strongly expressed in pancreas and liver .
Reactome Pathway
TGF-beta receptor signaling activates SMADs (R-HSA-2173789 )
Molecules associated with elastic fibres (R-HSA-2129379 )

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Brachyolmia-amelogenesis imperfecta syndrome DISTPSZ0 Definitive Autosomal recessive [1]
Breast cancer DIS7DPX1 Definitive Biomarker [2]
Breast carcinoma DIS2UE88 Definitive Biomarker [2]
Amelogenesis imperfecta DISGYR9E Strong Genetic Variation [3]
Anxiety DISIJDBA Strong Genetic Variation [4]
Anxiety disorder DISBI2BT Strong Genetic Variation [4]
Autoimmune disease DISORMTM Strong Biomarker [5]
Bone disease DISE1F82 Strong Biomarker [6]
Brachyolmia DISK6FWF Strong Biomarker [1]
Cardiac disease DISVO1I5 Strong Genetic Variation [7]
Cardiac failure DISDC067 Strong Altered Expression [8]
Cervical cancer DISFSHPF Strong Biomarker [9]
Cervical carcinoma DIST4S00 Strong Biomarker [9]
Colon cancer DISVC52G Strong Biomarker [9]
Colon carcinoma DISJYKUO Strong Biomarker [9]
Congestive heart failure DIS32MEA Strong Altered Expression [8]
Depression DIS3XJ69 Strong Genetic Variation [10]
Epilepsy DISBB28L Strong Biomarker [11]
Esophageal squamous cell carcinoma DIS5N2GV Strong Biomarker [12]
Geleophysic dysplasia 3 DIS1WMWE Strong Autosomal dominant [13]
Glaucoma/ocular hypertension DISLBXBY Strong Biomarker [14]
Head and neck cancer DISBPSQZ Strong Genetic Variation [15]
Head and neck carcinoma DISOU1DS Strong Genetic Variation [15]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [16]
Major depressive disorder DIS4CL3X Strong Genetic Variation [17]
Melanoma DIS1RRCY Strong Biomarker [18]
Mental disorder DIS3J5R8 Strong Genetic Variation [19]
Mitral valve prolapse DISNCHQ3 Strong Biomarker [20]
Mood disorder DISLVMWO Strong Biomarker [21]
Neoplasm DISZKGEW Strong Biomarker [22]
Obsessive compulsive disorder DIS1ZMM2 Strong Biomarker [23]
Obstructive sleep apnea DIS0SVD1 Strong Biomarker [24]
Osteoarthritis DIS05URM Strong Biomarker [25]
Plasma cell myeloma DIS0DFZ0 Strong Altered Expression [26]
Post-traumatic stress disorder DISHL1EY Strong Biomarker [27]
Advanced cancer DISAT1Z9 moderate Genetic Variation [28]
Carcinoma DISH9F1N moderate Biomarker [22]
Nasopharyngeal carcinoma DISAOTQ0 moderate Biomarker [29]
Nervous system disease DISJ7GGT moderate Biomarker [30]
Obesity DIS47Y1K moderate Biomarker [30]
Squamous cell carcinoma DISQVIFL moderate Altered Expression [22]
Tooth agenesis DIS1PWC7 moderate Biomarker [20]
Tooth agenesis, selective, 1 DIS84ERL moderate Biomarker [20]
Acromicric dysplasia DISMV8M7 Supportive Autosomal dominant [13]
Geleophysic dysplasia DISZOO1G Supportive Autosomal dominant [13]
Malignant mesothelioma DISTHJGH Limited Altered Expression [31]
Mesothelioma DISKWK9M Limited Altered Expression [31]
------------------------------------------------------------------------------------
⏷ Show the Full List of 47 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Latent-transforming growth factor beta-binding protein 3 (LTBP3). [32]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Latent-transforming growth factor beta-binding protein 3 (LTBP3). [40]
TAK-243 DM4GKV2 Phase 1 TAK-243 increases the sumoylation of Latent-transforming growth factor beta-binding protein 3 (LTBP3). [42]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Latent-transforming growth factor beta-binding protein 3 (LTBP3). [44]
------------------------------------------------------------------------------------
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of Latent-transforming growth factor beta-binding protein 3 (LTBP3). [33]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Latent-transforming growth factor beta-binding protein 3 (LTBP3). [34]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of Latent-transforming growth factor beta-binding protein 3 (LTBP3). [35]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Latent-transforming growth factor beta-binding protein 3 (LTBP3). [36]
Marinol DM70IK5 Approved Marinol increases the expression of Latent-transforming growth factor beta-binding protein 3 (LTBP3). [37]
Selenium DM25CGV Approved Selenium increases the expression of Latent-transforming growth factor beta-binding protein 3 (LTBP3). [38]
Testosterone enanthate DMB6871 Approved Testosterone enanthate affects the expression of Latent-transforming growth factor beta-binding protein 3 (LTBP3). [39]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Latent-transforming growth factor beta-binding protein 3 (LTBP3). [41]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Latent-transforming growth factor beta-binding protein 3 (LTBP3). [43]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)

References

1 Mutations in the latent TGF-beta binding protein 3 (LTBP3) gene cause brachyolmia with amelogenesis imperfecta. Hum Mol Genet. 2015 Jun 1;24(11):3038-49. doi: 10.1093/hmg/ddv053. Epub 2015 Feb 10.
2 Self-compassion and hope in the context of body image disturbance and distress in breast cancer survivors.Psychooncology. 2019 Oct;28(10):2025-2032. doi: 10.1002/pon.5187. Epub 2019 Aug 14.
3 Enamel and dental anomalies in latent-transforming growth factor beta-binding protein 3 mutant mice.Eur J Oral Sci. 2017 Feb;125(1):8-17. doi: 10.1111/eos.12328.
4 An Internet-Based Compassion-Focused Intervention for Increased Self-Criticism: A Randomized Controlled Trial.Behav Ther. 2019 Mar;50(2):430-445. doi: 10.1016/j.beth.2018.08.003. Epub 2018 Aug 17.
5 Egr2 and Egr3 in regulatory T cells cooperatively control systemic autoimmunity through Ltbp3-mediated TGF-3 production.Proc Natl Acad Sci U S A. 2016 Dec 13;113(50):E8131-E8140. doi: 10.1073/pnas.1611286114. Epub 2016 Nov 30.
6 Oligodontia is caused by mutation in LTBP3, the gene encoding latent TGF-beta binding protein 3.Am J Hum Genet. 2009 Apr;84(4):519-23. doi: 10.1016/j.ajhg.2009.03.007. Epub 2009 Apr 2.
7 Health-related Quality of Life and Its Predictors in Korean Patients with Myocardial Infarction in the Acute Phase.Clin Nurs Res. 2021 Feb;30(2):161-170. doi: 10.1177/1054773819894692. Epub 2019 Dec 11.
8 LTBP-2 acts as a novel marker in human heart failure - a preliminary study.Biomarkers. 2012 Aug;17(5):407-15. doi: 10.3109/1354750X.2012.677860. Epub 2012 Apr 19.
9 Anti-Cancerous Potential of Polysaccharide Fractions Extracted from Peony Seed Dreg on Various Human Cancer Cell Lines Via Cell Cycle Arrest and Apoptosis.Front Pharmacol. 2017 Mar 3;8:102. doi: 10.3389/fphar.2017.00102. eCollection 2017.
10 Effects of a Required Large-Group Mindfulness Meditation Course on First-Year Medical Students' Mental Health and Quality of Life: a Randomized Controlled Trial.J Gen Intern Med. 2020 Mar;35(3):672-678. doi: 10.1007/s11606-019-05284-0. Epub 2019 Aug 26.
11 Assessment of psychiatric and behavioral adverse effects of antiepileptic drugs monotherapy: Could they have a neuroendocrine correlation in persons with epilepsy?.Epilepsy Behav. 2019 Nov;100(Pt A):106439. doi: 10.1016/j.yebeh.2019.07.040. Epub 2019 Sep 28.
12 The ECM protein LTBP-2 is a suppressor of esophageal squamous cell carcinoma tumor formation but higher tumor expression associates with poor patient outcome.Int J Cancer. 2011 Aug 1;129(3):565-73. doi: 10.1002/ijc.25698. Epub 2010 Nov 9.
13 Mutations in LTBP3 cause acromicric dysplasia and geleophysic dysplasia. J Med Genet. 2016 Jul;53(7):457-64. doi: 10.1136/jmedgenet-2015-103647. Epub 2016 Apr 11.
14 Latent TGF- binding protein-2 is essential for the development of ciliary zonule microfibrils.Hum Mol Genet. 2014 Nov 1;23(21):5672-82. doi: 10.1093/hmg/ddu283. Epub 2014 Jun 6.
15 Reliability and psychometric validity of Hindi version of Depression, Anxiety and Stress Scale-21 (DASS-21) for Hindi speaking Head Neck Cancer and Oral Potentially Malignant Disorders Patients.J Cancer Res Ther. 2019 Jul-Sep;15(3):653-658. doi: 10.4103/jcrt.JCRT_281_17.
16 HBx-related long non-coding RNA MALAT1 promotes cell metastasis via up-regulating LTBP3 in hepatocellular carcinoma.Am J Cancer Res. 2017 Apr 1;7(4):845-856. eCollection 2017.
17 Genome-wide meta-analysis of depression identifies 102 independent variants and highlights the importance of the prefrontal brain regions.Nat Neurosci. 2019 Mar;22(3):343-352. doi: 10.1038/s41593-018-0326-7. Epub 2019 Feb 4.
18 Latent transforming growth factor-beta-binding protein 2 is an adhesion protein for melanoma cells.J Biol Chem. 2003 Jul 4;278(27):24705-13. doi: 10.1074/jbc.M212953200. Epub 2003 Apr 25.
19 Screening for trauma-related symptoms via a smartphone app: The validity of Smart Assessment on your Mobile in referred police officers.Int J Methods Psychiatr Res. 2017 Sep;26(3):e1579. doi: 10.1002/mpr.1579.
20 New recessive truncating mutation in LTBP3 in a family with oligodontia, short stature, and mitral valve prolapse.Am J Med Genet A. 2015 Jun;167(6):1396-9. doi: 10.1002/ajmg.a.37049. Epub 2015 Apr 21.
21 Artificial Intelligence based facial recognition for Mood Charting among men on life style modification and it's correlation with cortisol.Asian J Psychiatr. 2019 Jun;43:101-104. doi: 10.1016/j.ajp.2019.05.017. Epub 2019 May 11.
22 LTBP3 promotes early metastatic events during cancer cell dissemination.Oncogene. 2018 Apr;37(14):1815-1829. doi: 10.1038/s41388-017-0075-1. Epub 2018 Jan 19.
23 Early maladaptive schemas and suicidal risk in an Iranian sample of patients with obsessive-compulsive disorder.Psychiatry Res. 2017 Sep;255:441-448. doi: 10.1016/j.psychres.2017.06.080. Epub 2017 Jun 27.
24 Assessment of the Depression, Anxiety, and Stress Scale (DASS-21) in untreated obstructive sleep apnea (OSA).Psychol Assess. 2017 Oct;29(10):1201-1209. doi: 10.1037/pas0000401. Epub 2016 Dec 12.
25 The mediating role of psychological symptoms on falls risk among older adults with osteoarthritis.Clin Interv Aging. 2017 Nov 28;12:2025-2032. doi: 10.2147/CIA.S149991. eCollection 2017.
26 Activation of LTBP3 gene by a long noncoding RNA (lncRNA) MALAT1 transcript in mesenchymal stem cells from multiple myeloma.J Biol Chem. 2014 Oct 17;289(42):29365-75. doi: 10.1074/jbc.M114.572693. Epub 2014 Sep 3.
27 In-Home Sleep Recordings in Military Veterans With Posttraumatic Stress Disorder Reveal Less REM and Deep Sleep <1 Hz.Front Hum Neurosci. 2018 May 11;12:196. doi: 10.3389/fnhum.2018.00196. eCollection 2018.
28 Multiple Group Confirmatory Factor Analysis of the DASS-21 Depression and Anxiety Scales: How Do They Perform in a Cancer Sample?.Psychol Rep. 2018 Jun;121(3):548-565. doi: 10.1177/0033294117727747. Epub 2017 Aug 24.
29 LTBP-2 confers pleiotropic suppression and promotes dormancy in a growth factor permissive microenvironment in nasopharyngeal carcinoma.Cancer Lett. 2012 Dec 1;325(1):89-98. doi: 10.1016/j.canlet.2012.06.005. Epub 2012 Jun 26.
30 Structure and Mechanism of the Divalent Anion/Na?Symporter.Int J Mol Sci. 2019 Jan 21;20(2):440. doi: 10.3390/ijms20020440.
31 Latent TGF- binding proteins (LTBPs) 1 and 3 differentially regulate transforming growth factor- activity in malignant mesothelioma.Hum Pathol. 2011 Feb;42(2):269-78. doi: 10.1016/j.humpath.2010.07.005. Epub 2010 Nov 24.
32 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
33 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
34 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
35 Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
36 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
37 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
38 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
39 Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
40 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
41 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
42 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
43 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
44 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.