Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPGDNQS)

• DOT Name: Neurotensin/neuromedin N (NTS)
• Gene Name: NTS
• Related Disease:
  Analgesia
  Advanced cancer
  Alcohol dependence
  Alzheimer disease
  Breast cancer
  Breast carcinoma
  Coeliac disease
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Constipation
  Depression
  Epithelial ovarian cancer
  Fatty liver disease
  Fibrolamellar liver cancer
  Glioma
  Hepatocellular carcinoma
  High blood pressure
  Lung cancer
  Lung carcinoma
  Matthew-Wood syndrome
  Neoplasm
  Neuroendocrine neoplasm
  Obesity
  Ovarian cancer
  Ovarian neoplasm
  Pancreatic ductal carcinoma
  Pancreatic tumour
  Parkinson disease
  Prostate cancer
  Prostate carcinoma
  Prostate neoplasm
  Restless legs syndrome
  Sciatic neuropathy
  Squamous cell carcinoma
  Type-1/2 diabetes
  Mood disorder
  Non-insulin dependent diabetes
  Non-small-cell lung cancer
  Triple negative breast cancer
  Colitis
  Non-alcoholic fatty liver disease
  Adenocarcinoma
  Adult glioblastoma
  Breast neoplasm
  Cardiovascular disease
  Cognitive impairment
  Glioblastoma multiforme
  Pancreatic cancer
  Small-cell lung cancer
• UniProt ID: NEUT_HUMAN
• PDB ID: 2LNE; 2LNF; 2LNG; 2LYW; 2OYV; 2OYW; 3F6K; 4PO7; 5LUZ; 6UP7
• Pfam ID: PF07421
• Sequence:
  MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLN
  VCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWE
  LIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY
• Function: Neurotensin may play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle.
• KEGG Pathway: Neuroactive ligand-receptor interaction (hsa04080)
• Reactome Pathway:
  G alpha (q) signalling events (R-HSA-416476)
  Peptide ligand-binding receptors (R-HSA-375276)

Molecular Interaction Atlas (MIA) of This DOT

50 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Analgesia	DISK3TVI	Definitive	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Alcohol dependence	DIS4ZSCO	Strong	Biomarker	[3]
Alzheimer disease	DISF8S70	Strong	Altered Expression	[4]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[5]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[5]
Coeliac disease	DISIY60C	Strong	Biomarker	[6]
Colon cancer	DISVC52G	Strong	Altered Expression	[7]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[7]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[2]
Constipation	DISRQXWI	Strong	Genetic Variation	[1]
Depression	DIS3XJ69	Strong	Genetic Variation	[8]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[9]
Fatty liver disease	DIS485QZ	Strong	Biomarker	[10]
Fibrolamellar liver cancer	DISUDA2P	Strong	Biomarker	[11]
Glioma	DIS5RPEH	Strong	Biomarker	[12]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[13]
High blood pressure	DISY2OHH	Strong	Genetic Variation	[14]
Lung cancer	DISCM4YA	Strong	Biomarker	[15]
Lung carcinoma	DISTR26C	Strong	Biomarker	[15]
Matthew-Wood syndrome	DISA7HR7	Strong	Biomarker	[16]
Neoplasm	DISZKGEW	Strong	Biomarker	[17]
Neuroendocrine neoplasm	DISNPLOO	Strong	Altered Expression	[18]
Obesity	DIS47Y1K	Strong	Biomarker	[10]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[9]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[9]
Pancreatic ductal carcinoma	DIS26F9Q	Strong	Altered Expression	[19]
Pancreatic tumour	DIS3U0LK	Strong	Altered Expression	[20]
Parkinson disease	DISQVHKL	Strong	Biomarker	[21]
Prostate cancer	DISF190Y	Strong	Biomarker	[22]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[22]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[23]
Restless legs syndrome	DISNWY00	Strong	Genetic Variation	[24]
Sciatic neuropathy	DISMGDKX	Strong	Biomarker	[25]
Squamous cell carcinoma	DISQVIFL	Strong	Genetic Variation	[26]
Type-1/2 diabetes	DISIUHAP	Strong	Altered Expression	[27]
Mood disorder	DISLVMWO	moderate	Biomarker	[28]
Non-insulin dependent diabetes	DISK1O5Z	moderate	Biomarker	[27]
Non-small-cell lung cancer	DIS5Y6R9	moderate	Biomarker	[29]
Triple negative breast cancer	DISAMG6N	moderate	Biomarker	[30]
Colitis	DISAF7DD	Disputed	Biomarker	[31]
Non-alcoholic fatty liver disease	DISDG1NL	Disputed	Altered Expression	[32]
Adenocarcinoma	DIS3IHTY	Limited	Biomarker	[33]
Adult glioblastoma	DISVP4LU	Limited	Biomarker	[34]
Breast neoplasm	DISNGJLM	Limited	Altered Expression	[35]
Cardiovascular disease	DIS2IQDX	Limited	Altered Expression	[27]
Cognitive impairment	DISH2ERD	Limited	Altered Expression	[36]
Glioblastoma multiforme	DISK8246	Limited	Biomarker	[37]
Pancreatic cancer	DISJC981	Limited	Biomarker	[38]
Small-cell lung cancer	DISK3LZD	Limited	Biomarker	[39]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	Neurotensin/neuromedin N (NTS) affects the response to substance of Fluorouracil.	[50]
Bicalutamide	DMZMSPF	Approved	Neurotensin/neuromedin N (NTS) decreases the response to substance of Bicalutamide.	[51]

20 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Neurotensin/neuromedin N (NTS).	[40]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Neurotensin/neuromedin N (NTS).	[41]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Neurotensin/neuromedin N (NTS).	[42]
Quercetin	DM3NC4M	Approved	Quercetin increases the activity of Neurotensin/neuromedin N (NTS).	[43]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Neurotensin/neuromedin N (NTS).	[44]
Azacitidine	DMTA5OE	Approved	Azacitidine decreases the expression of Neurotensin/neuromedin N (NTS).	[45]
Prasterone	DM67VKL	Approved	Prasterone affects the expression of Neurotensin/neuromedin N (NTS).	[46]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone affects the expression of Neurotensin/neuromedin N (NTS).	[46]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate decreases the activity of Neurotensin/neuromedin N (NTS).	[43]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Neurotensin/neuromedin N (NTS).	[47]
PMID26560530-Compound-35	DMO36RL	Patented	PMID26560530-Compound-35 increases the activity of Neurotensin/neuromedin N (NTS).	[43]
PMID28460551-Compound-3	DMA1FRM	Patented	PMID28460551-Compound-3 increases the activity of Neurotensin/neuromedin N (NTS).	[43]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Neurotensin/neuromedin N (NTS).	[49]
Okadaic acid	DM47CO1	Investigative	Okadaic acid decreases the activity of Neurotensin/neuromedin N (NTS).	[43]
Staurosporine	DM0E9BR	Investigative	Staurosporine increases the activity of Neurotensin/neuromedin N (NTS).	[43]
Chelerythrine	DMCP1G9	Investigative	Chelerythrine increases the activity of Neurotensin/neuromedin N (NTS).	[43]
Bisindolylmaleimide-I	DMOQJZC	Investigative	Bisindolylmaleimide-I increases the activity of Neurotensin/neuromedin N (NTS).	[43]
G6976	DMEZO4M	Investigative	G6976 increases the activity of Neurotensin/neuromedin N (NTS).	[43]
Go 6983	DMKVTZN	Investigative	Go 6983 increases the activity of Neurotensin/neuromedin N (NTS).	[43]
Sucrose	DMVWUCF	Investigative	Sucrose decreases the activity of Neurotensin/neuromedin N (NTS).	[43]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the methylation of Neurotensin/neuromedin N (NTS).	[48]

References

• [1] The combination of opioid and neurotensin receptor agonists improves their analgesic/adverse effect ratio.Eur J Pharmacol. 2019 Apr 5;848:80-87. doi: 10.1016/j.ejphar.2019.01.048. Epub 2019 Jan 29.
• [2] Changes in plasma levels of cholecystokinin, neurotensin, VIP and PYY in gastric and colorectal cancer - Preliminary results.Peptides. 2019 Dec;122:170148. doi: 10.1016/j.peptides.2019.170148. Epub 2019 Sep 18.
• [3] Association between neurotensin receptor 1 gene polymorphisms and alcohol dependence in a male Han Chinese population.J Mol Neurosci. 2013 Oct;51(2):408-15. doi: 10.1007/s12031-013-0041-5. Epub 2013 Jun 8.
• [4] Potential roles of neurotensin on cognition in conditions of obese-insulin resistance.Neuropeptides. 2018 Dec;72:12-22. doi: 10.1016/j.npep.2018.09.002. Epub 2018 Sep 8.
• [5] Activation of EGFR, HER2 and HER3 by neurotensin/neurotensin receptor 1 renders breast tumors aggressive yet highly responsive to lapatinib and metformin in mice.Oncotarget. 2014 Sep 30;5(18):8235-51. doi: 10.18632/oncotarget.1632.
• [6] An Overview of Celiac Disease in Childhood Type 1 Diabetes.Int J Endocrinol Metab. 2018 Jun 27;16(3):e66801. doi: 10.5812/ijem.66801. eCollection 2018 Jul.
• [7] In vitro and in vivo treatment of colon cancer by VIP antagonists.Regul Pept. 2002 Nov 15;109(1-3):127-33. doi: 10.1016/s0167-0115(02)00195-7.
• [8] Focal Adhesion Kinase-Dependent Role of the Soluble Form of Neurotensin Receptor-3/Sortilin in Colorectal Cancer Cell Dissociation.Int J Mol Sci. 2016 Nov 8;17(11):1860. doi: 10.3390/ijms17111860.
• [9] Increased expression of neurotensin in high grade serous ovarian carcinoma with evidence of serous tubal intraepithelial carcinoma.J Pathol. 2019 Jul;248(3):352-362. doi: 10.1002/path.5264. Epub 2019 May 14.
• [10] Long-Acting Neurotensin Synergizes With Liraglutide to Reverse Obesity Through a Melanocortin-Dependent Pathway.Diabetes. 2019 Jun;68(6):1329-1340. doi: 10.2337/db18-1009. Epub 2019 Apr 1.
• [11] Neurotensin as a source of cyclic AMP and co-mitogen in fibrolamellar hepatocellular carcinoma.Oncotarget. 2019 Aug 20;10(49):5092-5102. doi: 10.18632/oncotarget.27149. eCollection 2019 Aug 20.
• [12] Neurotensin promotes the progression of malignant glioma through NTSR1 and impacts the prognosis of glioma patients.Mol Cancer. 2015 Feb 3;14:21. doi: 10.1186/s12943-015-0290-8.
• [13] Neurotensin/IL-8 pathway orchestrates local inflammatory response and tumor invasion by inducing M2 polarization of Tumor-Associated macrophages and epithelial-mesenchymal transition of hepatocellular carcinoma cells.Oncoimmunology. 2018 Mar 13;7(7):e1440166. doi: 10.1080/2162402X.2018.1440166. eCollection 2018.
• [14] Neuropeptide changes in the suprachiasmatic nucleus are associated with the development of hypertension.Chronobiol Int. 2019 Aug;36(8):1072-1087. doi: 10.1080/07420528.2019.1613424. Epub 2019 May 29.
• [15] Modulation of lung cancer cell plasticity and heterogeneity with the restoration of cisplatin sensitivity by neurotensin antibody.Cancer Lett. 2019 Mar 1;444:147-161. doi: 10.1016/j.canlet.2018.12.007. Epub 2018 Dec 21.
• [16] Preclinical Evaluation of (68)Ga-DOTA-NT-20.3: A Promising PET Imaging Probe To Discriminate Human Pancreatic Ductal Adenocarcinoma from Pancreatitis.Mol Pharm. 2019 Jun 3;16(6):2776-2784. doi: 10.1021/acs.molpharmaceut.9b00283. Epub 2019 May 3.
• [17] Hydrophilic (18)F-labeled trans-5-oxocene (oxoTCO) for efficient construction of PET agents with improved tumor-to-background ratios in neurotensin receptor (NTR) imaging.Chem Commun (Camb). 2019 Feb 21;55(17):2485-2488. doi: 10.1039/c8cc09747j.
• [18] Neurotensin Receptor 3/Sortilin Contributes to Tumorigenesis of Neuroendocrine Tumors Through Augmentation of Cell Adhesion and Migration.Neoplasia. 2018 Feb;20(2):175-181. doi: 10.1016/j.neo.2017.11.012. Epub 2017 Dec 19.
• [19] Evidence of (68)Ga-DOTA-NT-20.3 Uptake in Pancreatic Adenocarcinoma AsPC-1 Cell Line - in vitro Study.Curr Pharm Biotechnol. 2018;19(9):754-759. doi: 10.2174/1389201019666180829152314.
• [20] Radiopharmaceuticals for imaging and endoradiotherapy of neurotensin receptor-positive tumors.J Labelled Comp Radiopharm. 2018 Mar;61(3):309-325. doi: 10.1002/jlcr.3581. Epub 2018 Jan 5.
• [21] Development of a Parenteral Formulation of NTS-Polyplex Nanoparticles for Clinical Purpose.Pharmaceutics. 2018 Jan 3;10(1):5. doi: 10.3390/pharmaceutics10010005.
• [22] Neurotensin and its receptors mediate neuroendocrine transdifferentiation in prostate cancer.Oncogene. 2019 Jun;38(24):4875-4884. doi: 10.1038/s41388-019-0750-5. Epub 2019 Feb 15.
• [23] Neurotensin receptor binding and neurotensin-induced growth signaling in prostate cancer PC3 cells are sensitive to metabolic stress.Regul Pept. 2007 Jun 7;141(1-3):140-53. doi: 10.1016/j.regpep.2006.12.027. Epub 2007 Jan 16.
• [24] Genetic association studies of neurotensin gene and restless legs syndrome in French Canadians.Sleep Med. 2008 Mar;9(3):273-82. doi: 10.1016/j.sleep.2007.03.020. Epub 2007 Jul 17.
• [25] Chronic pain increases brainstem proneurotensin/neuromedin-N mRNA expression: a hybridization-histochemical and immunohistochemical study using three different rat models for chronic nociception.Brain Res. 1993 May 14;611(1):87-102. doi: 10.1016/s0006-8993(93)90001-4.
• [26] Identification of a novel therapeutic target for head and neck squamous cell carcinomas: a role for the neurotensin-neurotensin receptor 1 oncogenic signaling pathway.Int J Cancer. 2008 Oct 15;123(8):1816-23. doi: 10.1002/ijc.23710.
• [27] Association between systemic leptin and neurotensin concentration in adult individuals with and without type 2 diabetes mellitus.J Endocrinol Invest. 2018 Oct;41(10):1159-1163. doi: 10.1007/s40618-018-0845-9. Epub 2018 Feb 7.
• [28] Altered sleep and affect in the neurotensin receptor 1 knockout mouse.Sleep. 2012 Jul 1;35(7):949-56. doi: 10.5665/sleep.1958.
• [29] Neurotensin receptors regulate transactivation of the EGFR and HER2 in a reactive oxygen species-dependent manner.Eur J Pharmacol. 2019 Dec 15;865:172735. doi: 10.1016/j.ejphar.2019.172735. Epub 2019 Oct 12.
• [30] Dimeric Prodrug Self-Delivery Nanoparticles with Enhanced Drug Loading and Bioreduction Responsiveness for Targeted Cancer Therapy.ACS Appl Mater Interfaces. 2018 Nov 21;10(46):39455-39467. doi: 10.1021/acsami.8b09730. Epub 2018 Nov 9.
• [31] Neurotensin Promotes the Development of Colitis and Intestinal Angiogenesis via Hif-1-miR-210 Signaling.J Immunol. 2016 May 15;196(10):4311-21. doi: 10.4049/jimmunol.1501443. Epub 2016 Apr 13.
• [32] Neurotensin Is a Lipid-Induced Gastrointestinal Peptide Associated with Visceral Adipose Tissue Inflammation in Obesity.Nutrients. 2018 Apr 23;10(4):526. doi: 10.3390/nu10040526.
• [33] Future of Theranostics: An Outlook on Precision Oncology in Nuclear Medicine.J Nucl Med. 2019 Sep;60(Suppl 2):13S-19S. doi: 10.2967/jnumed.118.220566.
• [34] A Novel Positive Feedback Loop Between NTSR1 and Wnt/-Catenin Contributes to Tumor Growth of Glioblastoma.Cell Physiol Biochem. 2017;43(5):2133-2142. doi: 10.1159/000484232. Epub 2017 Oct 24.
• [35] Neurotensin receptor 1 facilitates intracellular and transepithelial delivery of macromolecules.Eur J Pharm Biopharm. 2017 Oct;119:300-309. doi: 10.1016/j.ejpb.2017.06.027. Epub 2017 Jul 6.
• [36] Pioglitazone abolishes cognition impairments as well as BDNF and neurotensin disturbances in a rat model of autism.Biol Open. 2019 May 13;8(5):bio041327. doi: 10.1242/bio.041327.
• [37] New extracellular factors in glioblastoma multiforme development: neurotensin, growth differentiation factor-15, sphingosine-1-phosphate and cytomegalovirus infection.Oncotarget. 2018 Jan 9;9(6):7219-7270. doi: 10.18632/oncotarget.24102. eCollection 2018 Jan 23.
• [38] New neurotensin analogue radiolabeled by 99m-technetium as a potential agent for tumor identification.Chem Biol Drug Des. 2018 Jan;91(1):304-313. doi: 10.1111/cbdd.13082. Epub 2017 Sep 12.
• [39] Neuropeptide G Protein-Coupled Receptors as Oncotargets.Front Endocrinol (Lausanne). 2018 Jun 29;9:345. doi: 10.3389/fendo.2018.00345. eCollection 2018.
• [40] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [41] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [42] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [43] Protein kinase C inhibitors alter neurotensin receptor binding and function in prostate cancer PC3 cells. Regul Pept. 2008 Apr 10;147(1-3):96-109. doi: 10.1016/j.regpep.2008.01.009. Epub 2008 Feb 11.
• [44] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [45] The effect of DNA methylation inhibitor 5-Aza-2'-deoxycytidine on human endometrial stromal cells. Hum Reprod. 2010 Nov;25(11):2859-69.
• [46] Comparative effects of DHEA and DHT on gene expression in human LNCaP prostate cancer cells. Anticancer Res. 2006 Sep-Oct;26(5A):3205-15.
• [47] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [48] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [49] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [50] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.
• [51] A role for neurotensin in bicalutamide resistant prostate cancer cells. Prostate. 2007 Feb 1;67(2):190-202. doi: 10.1002/pros.20518.