Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPHHYZJ)

• DOT Name: Cyclin-A2 (CCNA2)
• Synonyms: Cyclin-A; Cyclin A
• Gene Name: CCNA2
• UniProt ID: CCNA2_HUMAN
• PDB ID: 1E9H ; 1FIN ; 1FVV ; 1GY3 ; 1H1P ; 1H1Q ; 1H1R ; 1H1S ; 1H24 ; 1H25 ; 1H26 ; 1H27 ; 1H28 ; 1JST ; 1JSU ; 1OGU ; 1OI9 ; 1OIU ; 1OIY ; 1OKV ; 1OKW ; 1OL1 ; 1OL2 ; 1P5E ; 1PKD ; 1QMZ ; 1URC ; 1VYW ; 2BKZ ; 2BPM ; 2C4G ; 2C5N ; 2C5O ; 2C5V ; 2C5X ; 2C6T ; 2CCH ; 2CCI ; 2CJM ; 2I40 ; 2IW6 ; 2IW8 ; 2IW9 ; 2UUE ; 2UZB ; 2UZD ; 2UZE ; 2UZL ; 2V22 ; 2WEV ; 2WFY ; 2WHB ; 2WIH ; 2WIP ; 2WMA ; 2WMB ; 2WPA ; 2WXV ; 2X1N ; 3EID ; 3EJ1 ; 3EOC ; 3F5X ; 4BCK ; 4BCM ; 4BCN ; 4BCP ; 4CFM ; 4CFN ; 4CFU ; 4CFV ; 4CFW ; 4CFX ; 4EOI ; 4EOJ ; 4EOK ; 4EOL ; 4EOM ; 4EON ; 4EOO ; 4EOP ; 4EOQ ; 4EOR ; 4EOS ; 4FX3 ; 5CYI ; 5IF1 ; 5LMK ; 5NEV ; 6ATH ; 6GVA ; 6P3W ; 6Q6G ; 6Q6H ; 6RIJ ; 6SG4 ; 7ACK ; 7B5L ; 7B5R ; 7B7S ; 7LUO ; 7MKX ; 7QHL ; 8B54 ; 8BYA ; 8BZO
• Pfam ID: PF02984 ; PF00134 ; PF16500
• Sequence:
  MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKSGNPRG
  LAQQQRPKTRRVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKI
  EREDALAFNSAISLPGPRKPLVPLDYPMDGSFESPHTMDMSIILEDEKPVSVNEVPDYHE
  DIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYID
  RFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLK
  VLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAF
  HLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHG
  VSLLNPPETLNL
• Function: Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine protein kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 or CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.
• KEGG Pathway:
  Cell cycle (hsa04110)
  AMPK sig.ling pathway (hsa04152)
  Cellular senescence (hsa04218)
  Progesterone-mediated oocyte maturation (hsa04914)
  Hepatitis B (hsa05161)
  Human papillomavirus infection (hsa05165)
  Human T-cell leukemia virus 1 infection (hsa05166)
  Epstein-Barr virus infection (hsa05169)
  Pathways in cancer (hsa05200)
  Transcriptio.l misregulation in cancer (hsa05202)
  Viral carcinogenesis (hsa05203)
  Acute myeloid leukemia (hsa05221)
• Reactome Pathway:
  G0 and Early G1 (R-HSA-1538133)
  Phosphorylation of proteins involved in the G2/M transition by Cyclin A (R-HSA-170145)
  Telomere Extension By Telomerase (R-HSA-171319)
  Cdc20 (R-HSA-174184)
  Regulation of APC/C activators between G1/S and early anaphase (R-HSA-176408)
  SCF(Skp2)-mediated degradation of p27/p21 (R-HSA-187577)
  Senescence-Associated Secretory Phenotype (SASP) (R-HSA-2559582)
  DNA Damage/Telomere Stress Induced Senescence (R-HSA-2559586)
  Ub-specific processing proteases (R-HSA-5689880)
  Processing of DNA double-strand break ends (R-HSA-5693607)
  TP53 Regulates Transcription of Genes Involved in G1 Cell Cycle Arrest (R-HSA-6804116)
  Regulation of TP53 Activity through Phosphorylation (R-HSA-6804756)
  Regulation of TP53 Degradation (R-HSA-6804757)
  G2 Phase (R-HSA-68911)
  Orc1 removal from chromatin (R-HSA-68949)
  CDK-mediated phosphorylation and removal of Cdc6 (R-HSA-69017)
  Cyclin A/B1/B2 associated events during G2/M transition (R-HSA-69273)
  p53-Dependent G1 DNA Damage Response (R-HSA-69563)
  Cyclin A (R-HSA-69656)
  Transcription of E2F targets under negative control by p107 (RBL1) and p130 (RBL2) in complex with HDAC1 (R-HSA-1362300)

Molecular Interaction Atlas (MIA) of This DOT

99 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Cyclin-A2 (CCNA2).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Cyclin-A2 (CCNA2).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Cyclin-A2 (CCNA2).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Cyclin-A2 (CCNA2).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Cyclin-A2 (CCNA2).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Cyclin-A2 (CCNA2).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Cyclin-A2 (CCNA2).	[7]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Cyclin-A2 (CCNA2).	[8]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Cyclin-A2 (CCNA2).	[9]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of Cyclin-A2 (CCNA2).	[10]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Cyclin-A2 (CCNA2).	[11]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Cyclin-A2 (CCNA2).	[12]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Cyclin-A2 (CCNA2).	[13]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Cyclin-A2 (CCNA2).	[14]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Cyclin-A2 (CCNA2).	[15]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Cyclin-A2 (CCNA2).	[14]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Cyclin-A2 (CCNA2).	[16]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Cyclin-A2 (CCNA2).	[17]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Cyclin-A2 (CCNA2).	[18]
Menadione	DMSJDTY	Approved	Menadione decreases the expression of Cyclin-A2 (CCNA2).	[13]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Cyclin-A2 (CCNA2).	[5]
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the expression of Cyclin-A2 (CCNA2).	[19]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Cyclin-A2 (CCNA2).	[20]
Folic acid	DMEMBJC	Approved	Folic acid increases the expression of Cyclin-A2 (CCNA2).	[21]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of Cyclin-A2 (CCNA2).	[22]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Cyclin-A2 (CCNA2).	[23]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the expression of Cyclin-A2 (CCNA2).	[24]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Cyclin-A2 (CCNA2).	[25]
Etoposide	DMNH3PG	Approved	Etoposide decreases the expression of Cyclin-A2 (CCNA2).	[26]
Irinotecan	DMP6SC2	Approved	Irinotecan decreases the expression of Cyclin-A2 (CCNA2).	[27]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of Cyclin-A2 (CCNA2).	[28]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Cyclin-A2 (CCNA2).	[29]
Malathion	DMXZ84M	Approved	Malathion decreases the expression of Cyclin-A2 (CCNA2).	[30]
Azacitidine	DMTA5OE	Approved	Azacitidine decreases the expression of Cyclin-A2 (CCNA2).	[31]
Cocaine	DMSOX7I	Approved	Cocaine decreases the expression of Cyclin-A2 (CCNA2).	[32]
Simvastatin	DM30SGU	Approved	Simvastatin decreases the expression of Cyclin-A2 (CCNA2).	[33]
Mifepristone	DMGZQEF	Approved	Mifepristone decreases the expression of Cyclin-A2 (CCNA2).	[34]
Zidovudine	DM4KI7O	Approved	Zidovudine decreases the expression of Cyclin-A2 (CCNA2).	[35]
Sulindac	DM2QHZU	Approved	Sulindac decreases the expression of Cyclin-A2 (CCNA2).	[36]
Capsaicin	DMGMF6V	Approved	Capsaicin decreases the expression of Cyclin-A2 (CCNA2).	[37]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of Cyclin-A2 (CCNA2).	[38]
Palbociclib	DMD7L94	Approved	Palbociclib decreases the expression of Cyclin-A2 (CCNA2).	[39]
Pioglitazone	DMKJ485	Approved	Pioglitazone decreases the expression of Cyclin-A2 (CCNA2).	[24]
Acocantherin	DM7JT24	Approved	Acocantherin decreases the expression of Cyclin-A2 (CCNA2).	[40]
Liothyronine	DM6IR3P	Approved	Liothyronine increases the expression of Cyclin-A2 (CCNA2).	[41]
Bicalutamide	DMZMSPF	Approved	Bicalutamide decreases the expression of Cyclin-A2 (CCNA2).	[42]
Hydroxyurea	DMOQVU9	Approved	Hydroxyurea increases the expression of Cyclin-A2 (CCNA2).	[43]
Fluoxetine	DM3PD2C	Approved	Fluoxetine decreases the expression of Cyclin-A2 (CCNA2).	[44]
Imatinib	DM7RJXL	Approved	Imatinib decreases the expression of Cyclin-A2 (CCNA2).	[45]
Ritonavir	DMU764S	Approved	Ritonavir decreases the expression of Cyclin-A2 (CCNA2).	[46]
Orlistat	DMRJSP8	Approved	Orlistat decreases the expression of Cyclin-A2 (CCNA2).	[47]
Ximelegatran	DMU8ANS	Approved	Ximelegatran decreases the expression of Cyclin-A2 (CCNA2).	[48]
Romidepsin	DMT5GNL	Approved	Romidepsin decreases the expression of Cyclin-A2 (CCNA2).	[49]
Lapatinib	DM3BH1Y	Approved	Lapatinib decreases the expression of Cyclin-A2 (CCNA2).	[50]
Clofibrate	DMPC1J7	Approved	Clofibrate decreases the expression of Cyclin-A2 (CCNA2).	[51]
Gamolenic acid	DMQN30Z	Approved	Gamolenic acid decreases the expression of Cyclin-A2 (CCNA2).	[52]
Teriflunomide	DMQ2FKJ	Approved	Teriflunomide increases the expression of Cyclin-A2 (CCNA2).	[53]
LY2835219	DM93VBZ	Approved	LY2835219 decreases the expression of Cyclin-A2 (CCNA2).	[54]
Omacetaxine mepesuccinate	DMPU2WX	Approved	Omacetaxine mepesuccinate decreases the expression of Cyclin-A2 (CCNA2).	[55]
Cilostazol	DMZMSCT	Approved	Cilostazol decreases the expression of Cyclin-A2 (CCNA2).	[57]
Lamivudine	DMI347A	Approved	Lamivudine decreases the expression of Cyclin-A2 (CCNA2).	[35]
Trabectedin	DMG3Y89	Approved	Trabectedin decreases the expression of Cyclin-A2 (CCNA2).	[58]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Cyclin-A2 (CCNA2).	[59]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Cyclin-A2 (CCNA2).	[60]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Cyclin-A2 (CCNA2).	[61]
Fenretinide	DMRD5SP	Phase 3	Fenretinide decreases the expression of Cyclin-A2 (CCNA2).	[62]
Camptothecin	DM6CHNJ	Phase 3	Camptothecin decreases the expression of Cyclin-A2 (CCNA2).	[63]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol decreases the expression of Cyclin-A2 (CCNA2).	[64]
HMPL-004	DM29XGY	Phase 3	HMPL-004 decreases the expression of Cyclin-A2 (CCNA2).	[65]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Cyclin-A2 (CCNA2).	[66]
Phenol	DM1QSM3	Phase 2/3	Phenol decreases the expression of Cyclin-A2 (CCNA2).	[67]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of Cyclin-A2 (CCNA2).	[68]
GSK2110183	DMZHB37	Phase 2	GSK2110183 decreases the expression of Cyclin-A2 (CCNA2).	[69]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene increases the expression of Cyclin-A2 (CCNA2).	[19]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of Cyclin-A2 (CCNA2).	[70]
PEITC	DMOMN31	Phase 2	PEITC decreases the expression of Cyclin-A2 (CCNA2).	[71]
BAICALEIN	DM4C7E6	Phase 2	BAICALEIN decreases the expression of Cyclin-A2 (CCNA2).	[72]
R-roscovitine	DMSH108	Phase 2	R-roscovitine decreases the expression of Cyclin-A2 (CCNA2).	[39]
Amsilarotene	DMOB01U	Phase 2	Amsilarotene decreases the expression of Cyclin-A2 (CCNA2).	[73]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Cyclin-A2 (CCNA2).	[26]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Cyclin-A2 (CCNA2).	[74]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Cyclin-A2 (CCNA2).	[75]
LY294002	DMY1AFS	Phase 1	LY294002 decreases the expression of Cyclin-A2 (CCNA2).	[76]
Tetrandrine	DMAOJBX	Phase 1	Tetrandrine increases the expression of Cyclin-A2 (CCNA2).	[77]
Ribavirin	DMEYLH9	Phase 1 Trial	Ribavirin decreases the expression of Cyclin-A2 (CCNA2).	[78]
TAK-114	DMTXE19	Phase 1	TAK-114 decreases the expression of Cyclin-A2 (CCNA2).	[79]
IRX4204	DM9SCME	Phase 1	IRX4204 decreases the expression of Cyclin-A2 (CCNA2).	[51]
XK-469	DMVYO41	Phase 1	XK-469 increases the expression of Cyclin-A2 (CCNA2).	[80]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Cyclin-A2 (CCNA2).	[81]
Flavonoid derivative 1	DMCQP0B	Patented	Flavonoid derivative 1 decreases the expression of Cyclin-A2 (CCNA2).	[82]
Steroid derivative 1	DMB0NVQ	Patented	Steroid derivative 1 decreases the expression of Cyclin-A2 (CCNA2).	[83]
TDZD-8	DMG6Q45	Patented	TDZD-8 decreases the expression of Cyclin-A2 (CCNA2).	[84]
Perillyl alcohol	DMFWC3O	Discontinued in Phase 2	Perillyl alcohol decreases the expression of Cyclin-A2 (CCNA2).	[85]
LG100268	DM41RK2	Discontinued in Phase 1	LG100268 decreases the expression of Cyclin-A2 (CCNA2).	[24]
Aphidicolin	DM71C6D	Discontinued in Phase 1	Aphidicolin increases the expression of Cyclin-A2 (CCNA2).	[86]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Cyclin-A2 (CCNA2).	[87]
Dioscin	DM5H2W9	Preclinical	Dioscin decreases the expression of Cyclin-A2 (CCNA2).	[88]
Ciglitazone	DMAPO0T	Preclinical	Ciglitazone decreases the expression of Cyclin-A2 (CCNA2).	[51]
Nobiletin	DM7R3B6	Preclinical	Nobiletin decreases the expression of Cyclin-A2 (CCNA2).	[89]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Mechlorethamine	DM0CVXA	Approved	Mechlorethamine increases the stability of Cyclin-A2 (CCNA2).	[56]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Inter-laboratory comparison of human renal proximal tubule (HK-2) transcriptome alterations due to Cyclosporine A exposure and medium exhaustion. Toxicol In Vitro. 2009 Apr;23(3):486-99.
• [3] Constitutive gene expression predisposes morphogen-mediated cell fate responses of NT2/D1 and 27X-1 human embryonal carcinoma cells. Stem Cells. 2007 Mar;25(3):771-8. doi: 10.1634/stemcells.2006-0271. Epub 2006 Nov 30.
• [4] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [5] Cell-type-specific responses to chemotherapeutics in breast cancer. Cancer Res. 2004 Jun 15;64(12):4218-26.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Systematic transcriptome-based comparison of cellular adaptive stress response activation networks in hepatic stem cell-derived progeny and primary human hepatocytes. Toxicol In Vitro. 2021 Jun;73:105107. doi: 10.1016/j.tiv.2021.105107. Epub 2021 Feb 3.
• [8] Gene and protein expressions induced by 17beta-estradiol and parathion in cultured breast epithelial cells. Mol Med. 2007 May-Jun;13(5-6):255-65. doi: 10.2119/2006C00087.Calaf.
• [9] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [10] Influence of Iron on Cytotoxicity and Gene Expression Profiles Induced by Arsenic in HepG2 Cells. Int J Environ Res Public Health. 2019 Nov 14;16(22):4484. doi: 10.3390/ijerph16224484.
• [11] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [12] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [13] Gene expression after treatment with hydrogen peroxide, menadione, or t-butyl hydroperoxide in breast cancer cells. Cancer Res. 2002 Nov 1;62(21):6246-54.
• [14] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [15] Suberoylanilide hydroxamic acid (SAHA) potentiates paclitaxel-induced apoptosis in ovarian cancer cell lines. Gynecol Oncol. 2010 Jan;116(1):126-30. doi: 10.1016/j.ygyno.2009.09.039. Epub 2009 Oct 28.
• [16] Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
• [17] Delta 9-tetrahydrocannabinol inhibits cell cycle progression by downregulation of E2F1 in human glioblastoma multiforme cells. Acta Oncol. 2008;47(6):1062-70.
• [18] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [19] Estrogen regulation in human breast cancer cells of new downstream gene targets involved in estrogen metabolism, cell proliferation and cell transformation. J Mol Endocrinol. 2004 Apr;32(2):397-414.
• [20] Influence of resveratrol on rheumatoid fibroblast-like synoviocytes analysed with gene chip transcription. Phytomedicine. 2013 Feb 15;20(3-4):310-8. doi: 10.1016/j.phymed.2012.09.020. Epub 2012 Nov 6.
• [21] Folic acid mediates activation of the pro-oncogene STAT3 via the Folate Receptor alpha. Cell Signal. 2015 Jul;27(7):1356-68. doi: 10.1016/j.cellsig.2015.03.020. Epub 2015 Apr 2.
• [22] Cannabidiol and Oxygen-Ozone Combination Induce Cytotoxicity in Human Pancreatic Ductal Adenocarcinoma Cell Lines. Cancers (Basel). 2020 Sep 27;12(10):2774. doi: 10.3390/cancers12102774.
• [23] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [24] Thiazolidinediones inhibit proliferation of microvascular and macrovascular cells by a PPARgamma-independent mechanism. Diabetologia. 2005 Mar;48(3):586-94. doi: 10.1007/s00125-005-1672-z. Epub 2005 Feb 24.
• [25] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [26] Responses of genes involved in cell cycle control to diverse DNA damaging chemicals in human lung adenocarcinoma A549 cells. Cancer Cell Int. 2005 Aug 24;5:28. doi: 10.1186/1475-2867-5-28.
• [27] In vitro and in vivo irinotecan-induced changes in expression profiles of cell cycle and apoptosis-associated genes in acute myeloid leukemia cells. Mol Cancer Ther. 2005 Jun;4(6):885-900.
• [28] Rapid activation of Stat3 and ERK1/2 by nicotine modulates cell proliferation in human bladder cancer cells. Toxicol Sci. 2008 Aug;104(2):283-93. doi: 10.1093/toxsci/kfn086. Epub 2008 Apr 30.
• [29] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [30] The protective effects of the antioxidant N-acetylcysteine (NAC) against oxidative stress-associated apoptosis evoked by the organophosphorus insecticide malathion in normal human astrocytes. Toxicology. 2019 Apr 1;417:1-14.
• [31] The effect of DNA methylation inhibitor 5-Aza-2'-deoxycytidine on human endometrial stromal cells. Hum Reprod. 2010 Nov;25(11):2859-69.
• [32] A mechanism for the inhibition of neural progenitor cell proliferation by cocaine. PLoS Med. 2008 Jun 10;5(6):e117. doi: 10.1371/journal.pmed.0050117.
• [33] Simvastatin inactivates beta1-integrin and extracellular signal-related kinase signaling and inhibits cell proliferation in head and neck squamous cell carcinoma cells. Cancer Sci. 2007 Jun;98(6):890-9.
• [34] Mifepristone inhibits ovarian cancer cell growth in vitro and in vivo. Clin Cancer Res. 2007 Jun 1;13(11):3370-9. doi: 10.1158/1078-0432.CCR-07-0164.
• [35] Zidovudine induces S-phase arrest and cell cycle gene expression changes in human cells. Mutagenesis. 2005 Mar;20(2):139-46. doi: 10.1093/mutage/gei019. Epub 2005 Mar 22.
• [36] Sulindac induces specific degradation of the HPV oncoprotein E7 and causes growth arrest and apoptosis in cervical carcinoma cells. Cancer Lett. 2007 Jan 8;245(1-2):103-11. doi: 10.1016/j.canlet.2005.12.034. Epub 2006 Feb 20.
• [37] Capsaicin sensitizes malignant glioma cells to TRAIL-mediated apoptosis via DR5 upregulation and survivin downregulation. Carcinogenesis. 2010 Mar;31(3):367-75. doi: 10.1093/carcin/bgp298. Epub 2009 Nov 25.
• [38] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [39] Proliferative suppression by CDK4/6 inhibition: complex function of the retinoblastoma pathway in liver tissue and hepatoma cells. Gastroenterology. 2010 May;138(5):1920-30. doi: 10.1053/j.gastro.2010.01.007. Epub 2010 Jan 25.
• [40] Cardiotonic steroids attenuate ERK phosphorylation and generate cell cycle arrest to block human hepatoma cell growth. J Steroid Biochem Mol Biol. 2011 Jul;125(3-5):181-91. doi: 10.1016/j.jsbmb.2010.12.016. Epub 2011 Jan 6.
• [41] 3,5,3'-triiodothyronine (T3) is a survival factor for pancreatic beta-cells undergoing apoptosis. J Cell Physiol. 2006 Feb;206(2):309-21. doi: 10.1002/jcp.20460.
• [42] Androgen receptor regulates Cdc6 in synchronized LNCaP cells progressing from G1 to S phase. J Cell Physiol. 2005 Aug;204(2):381-7. doi: 10.1002/jcp.20422.
• [43] The potential of iron chelators of the pyridoxal isonicotinoyl hydrazone class as effective antiproliferative agents, IV: The mechanisms involved in inhibiting cell-cycle progression. Blood. 2001 Aug 1;98(3):842-50. doi: 10.1182/blood.v98.3.842.
• [44] Fluoxetine mediates G0/G1 arrest by inducing functional inhibition of cyclin dependent kinase subunit (CKS)1. Biochem Pharmacol. 2008 May 15;75(10):1924-34. doi: 10.1016/j.bcp.2008.02.013. Epub 2008 Feb 17.
• [45] A systems biology understanding of the synergistic effects of arsenic sulfide and Imatinib in BCR/ABL-associated leukemia. Proc Natl Acad Sci U S A. 2009 Mar 3;106(9):3378-83.
• [46] Ritonavir blocks AKT signaling, activates apoptosis and inhibits migration and invasion in ovarian cancer cells. Mol Cancer. 2009 Apr 22;8:26. doi: 10.1186/1476-4598-8-26.
• [47] Orlistat Displays Antitumor Activity and Enhances the Efficacy of Paclitaxel in Human Hepatoma Hep3B Cells. Chem Res Toxicol. 2019 Feb 18;32(2):255-264. doi: 10.1021/acs.chemrestox.8b00269. Epub 2019 Jan 22.
• [48] ATPR induces acute promyelocytic leukemia cells differentiation and growth arrest by blockade of SHP2/Rho/ROCK1 pathway. Toxicol Appl Pharmacol. 2020 Jul 15;399:115053. doi: 10.1016/j.taap.2020.115053. Epub 2020 May 15.
• [49] Abrogation of p21 expression by flavopiridol enhances depsipeptide-mediated apoptosis in malignant pleural mesothelioma cells. Clin Cancer Res. 2004 Mar 1;10(5):1813-25. doi: 10.1158/1078-0432.ccr-0901-3.
• [50] CDK4/6 inhibition provides a potent adjunct to Her2-targeted therapies in preclinical breast cancer models. Genes Cancer. 2014 Jul;5(7-8):261-72. doi: 10.18632/genesandcancer.24.
• [51] Steroid receptor coactivator 1 deficiency increases MMTV-neu mediated tumor latency and differentiation specific gene expression, decreases metastasis, and inhibits response to PPAR ligands. BMC Cancer. 2010 Nov 16;10:629. doi: 10.1186/1471-2407-10-629.
• [52] A retinoid X receptor (RXR)-selective retinoid reveals that RXR-alpha is potentially a therapeutic target in breast cancer cell lines, and that it potentiates antiproliferative and apoptotic responses to peroxisome proliferator-activated receptor ligands. Breast Cancer Res. 2004;6(5):R546-55. doi: 10.1186/bcr913. Epub 2004 Jul 23.
• [53] A77 1726 induces differentiation of human myeloid leukemia K562 cells by depletion of intracellular CTP pools. Mol Pharmacol. 2002 Sep;62(3):463-72. doi: 10.1124/mol.62.3.463.
• [54] CDK4/6 Inhibition Controls Proliferation of Bladder Cancer and Transcription of RB1. J Urol. 2016 Mar;195(3):771-9. doi: 10.1016/j.juro.2015.08.082. Epub 2015 Aug 28.
• [55] Homoharringtonine suppresses LoVo cell growth by inhibiting EphB4 and the PI3K/AKT and MAPK/EKR1/2 signaling pathways. Food Chem Toxicol. 2020 Feb;136:110960. doi: 10.1016/j.fct.2019.110960. Epub 2019 Nov 11.
• [56] G2 delay induced by nitrogen mustard in human cells affects cyclin A/cdk2 and cyclin B1/cdc2-kinase complexes differently. J Biol Chem. 1993 Apr 15;268(11):8298-308.
• [57] Cilostazol inhibits vascular smooth muscle cell growth by downregulation of the transcription factor E2F. Hypertension. 2005 Apr;45(4):552-6. doi: 10.1161/01.HYP.0000158263.64320.eb. Epub 2005 Feb 21.
• [58] Selective effects of the anticancer drug Yondelis (ET-743) on cell-cycle promoters. Mol Pharmacol. 2005 Nov;68(5):1496-503. doi: 10.1124/mol.105.013615. Epub 2005 Jun 16.
• [59] Bone morphogenetic protein-2 induces hypophosphorylation of Rb protein and repression of E2F in androgen-treated LNCaP human prostate cancer cells. Int J Mol Med. 2005 Feb;15(2):253-8.
• [60] Structure-activity relationships of resveratrol and derivatives in breast cancer cells. Mol Nutr Food Res. 2009 Jul;53(7):845-58. doi: 10.1002/mnfr.200800331.
• [61] Bisphenol-A-induced inactivation of the p53 axis underlying deregulation of proliferation kinetics, and cell death in non-malignant human breast epithelial cells. Carcinogenesis. 2013 Mar;34(3):703-12. doi: 10.1093/carcin/bgs379. Epub 2012 Dec 7.
• [62] 4-oxo-fenretinide, a recently identified fenretinide metabolite, induces marked G2-M cell cycle arrest and apoptosis in fenretinide-sensitive and fenretinide-resistant cell lines. Cancer Res. 2006 Mar 15;66(6):3238-47. doi: 10.1158/0008-5472.CAN-05-3362.
• [63] Effects of folic acid on the antiproliferative efficiency of doxorubicin, camptothecin and methyl methanesulfonate in MCF-7 cells by mRNA endpoints. Saudi J Biol Sci. 2018 Dec;25(8):1568-1576. doi: 10.1016/j.sjbs.2016.02.005. Epub 2016 Feb 10.
• [64] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [65] Inhibition of cell-cycle progression in human colorectal carcinoma Lovo cells by andrographolide. Chem Biol Interact. 2008 Aug 11;174(3):201-10. doi: 10.1016/j.cbi.2008.06.006. Epub 2008 Jun 20.
• [66] Molecular signatures of soy-derived phytochemicals in androgen-responsive prostate cancer cells: a comparison study using DNA microarray. Mol Carcinog. 2006 Dec;45(12):943-56.
• [67] Phenol peels as a novel therapeutic approach for actinic keratosis and Bowen disease: prospective pilot trial with assessment of clinical, histologic, and immunohistochemical correlations. J Am Acad Dermatol. 2009 Apr;60(4):615-25. doi: 10.1016/j.jaad.2008.11.907.
• [68] Gene expression-signature of belinostat in cell lines is specific for histone deacetylase inhibitor treatment, with a corresponding signature in xenografts. Anticancer Drugs. 2009 Sep;20(8):682-92.
• [69] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [70] Comparison of gene expression profiles in HepG2 cells exposed to arsenic, cadmium, nickel, and three model carcinogens for investigating the mechanisms of metal carcinogenesis. Environ Mol Mutagen. 2009 Jan;50(1):46-59.
• [71] Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
• [72] The ethanol extract of Scutellaria baicalensis and the active compounds induce cell cycle arrest and apoptosis including upregulation of p53 and Bax in human lung cancer cells. Toxicol Appl Pharmacol. 2011 Aug 1;254(3):221-8. doi: 10.1016/j.taap.2011.03.016. Epub 2011 Mar 30.
• [73] Induction of cell-cycle arrest and apoptosis by a novel retinobenzoic-acid derivative, TAC-101, in human pancreatic-cancer cells. Int J Cancer. 1999 May 17;81(4):637-44.
• [74] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [75] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [76] Activation of mammalian target of rapamycin signaling promotes cell cycle progression and protects cells from apoptosis in mantle cell lymphoma. Am J Pathol. 2006 Dec;169(6):2171-80. doi: 10.2353/ajpath.2006.051078.
• [77] Tetrandrine and cepharanthine induce apoptosis through caspase cascade regulation, cell cycle arrest, MAPK activation and PI3K/Akt/mTOR signal modification in glucocorticoid resistant human leukemia Jurkat T cells. Chem Biol Interact. 2019 Sep 1;310:108726. doi: 10.1016/j.cbi.2019.108726. Epub 2019 Jun 28.
• [78] Ribavirin inhibits colorectal cancer growth by downregulating PRMT5 expression and H3R8me2s and H4R3me2s accumulation. Toxicol Appl Pharmacol. 2021 Mar 15;415:115450. doi: 10.1016/j.taap.2021.115450. Epub 2021 Feb 9.
• [79] In silico, in vitro and in vivo studies: Dibutyl phthalate promotes prostate cancer cell proliferation by activating Forkhead Box M1 and remission after Natura- pretreatment. Toxicology. 2023 Apr;488:153465. doi: 10.1016/j.tox.2023.153465. Epub 2023 Feb 23.
• [80] Mitotic arrest induced by XK469, a novel antitumor agent, is correlated with the inhibition of cyclin B1 ubiquitination. Int J Cancer. 2002 Jan 1;97(1):121-8. doi: 10.1002/ijc.1570.
• [81] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [82] Luteolin exerts anti-tumor activity through the suppression of epidermal growth factor receptor-mediated pathway in MDA-MB-231 ER-negative breast cancer cells. Food Chem Toxicol. 2012 Nov;50(11):4136-43. doi: 10.1016/j.fct.2012.08.025. Epub 2012 Aug 20.
• [83] 2-methoxyestradiol induces mitotic arrest, apoptosis, and synergistic cytotoxicity with arsenic trioxide in human urothelial carcinoma cells. PLoS One. 2013 Aug 13;8(8):e68703. doi: 10.1371/journal.pone.0068703. eCollection 2013.
• [84] Lithium suppresses cell proliferation by interrupting E2F-DNA interaction and subsequently reducing S-phase gene expression in prostate cancer. Prostate. 2007 Jun 15;67(9):976-88. doi: 10.1002/pros.20586.
• [85] Cell cycle arrest by the isoprenoids perillyl alcohol, geraniol, and farnesol is mediated by p21(Cip1) and p27(Kip1) in human pancreatic adenocarcinoma cells. J Pharmacol Exp Ther. 2007 Mar;320(3):1163-70. doi: 10.1124/jpet.106.111666. Epub 2006 Nov 30.
• [86] RXRalpha mRNA expression is associated with cell proliferation and cell cycle regulation in Hep3B cell. Exp Mol Pathol. 2004 Feb;76(1):24-8. doi: 10.1016/j.yexmp.2003.10.009.
• [87] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [88] Dioscin inhibits human endometrial carcinoma proliferation via G0/G1 cell cycle arrest and mitochondrial-dependent signaling pathway. Food Chem Toxicol. 2021 Feb;148:111941. doi: 10.1016/j.fct.2020.111941. Epub 2020 Dec 24.
• [89] Characteristics of nobiletin-mediated alteration of gene expression in cultured cell lines. Biochem Biophys Res Commun. 2013 Feb 15;431(3):530-4.