Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQW4HV6)

DOT Name Corneodesmosin (CDSN)
Synonyms S protein
Gene Name CDSN
Related Disease
Colonic neoplasm ( )
Advanced cancer ( )
Alopecia ( )
Alzheimer disease ( )
Behcet disease ( )
Bipolar disorder ( )
Breast neoplasm ( )
Coagulation defect ( )
Gastroenteritis ( )
Graves disease ( )
Hepatitis ( )
Hepatitis A virus infection ( )
Hepatitis B virus infection ( )
Hepatitis C virus infection ( )
Hepatocellular carcinoma ( )
Hereditary spastic paraplegia ( )
High blood pressure ( )
Hypotrichosis 2 ( )
Influenza ( )
Leukodystrophy ( )
Metastatic malignant neoplasm ( )
Middle East Respiratory Syndrome (MERS) ( )
Mood disorder ( )
Multiple sclerosis ( )
Osteoarthritis ( )
Peeling skin syndrome 1 ( )
Potocki-Shaffer syndrome ( )
Severe acute respiratory syndrome (SARS) ( )
Systemic sclerosis ( )
Thyroid gland carcinoma ( )
Adult glioblastoma ( )
Asthma ( )
Encephalitis ( )
Encephalitis/encephalopathy, mild, with reversible myelin vacuolization ( )
Glioblastoma multiforme ( )
Immune system disorder ( )
Leigh syndrome ( )
Myopathy ( )
Hypotrichosis simplex of the scalp ( )
Skin disease ( )
Ebola virus infection ( )
Glaucoma/ocular hypertension ( )
Hypotrichosis simplex ( )
Lateral meningocele syndrome ( )
Limb-mammary syndrome ( )
Neoplasm ( )
Rheumatoid arthritis ( )
Squamous cell carcinoma ( )
UniProt ID
CDSN_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MGSSRAPWMGRVGGHGMMALLLAGLLLPGTLAKSIGTFSDPCKDPTRITSPNDPCLTGKG
DSSGFSSYSGSSSSGSSISSARSSGGGSSGSSSGSSIAQGGSAGSFKPGTGYSQVSYSSG
SGSSLQGASGSSQLGSSSSHSGNSGSHSGSSSSHSSSSSSFQFSSSSFQVGNGSALPTND
NSYRGILNPSQPGQSSSSSQTFGVSSSGQSVSSNQRPCSSDIPDSPCSGGPIVSHSGPYI
PSSHSVSGGQRPVVVVVDQHGSGAPGVVQGPPCSNGGLPGKPCPPITSVDKSYGGYEVVG
GSSDSYLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNPIIPSQ
SAASSAIAFQPVGTGGVQLCGGGSTGSKGPCSPSSSRVPSSSSISSSSGLPYHPCGSASQ
SPCSPPGTGSFSSSSSSQSSGKIILQPCGSKSSSSGHPCMSVSSLTLTGGPDGSPHPDPS
AGAKPCGSSSAGKIPCRSIRDILAQVKPLGPQLADPEVFLPQGELLNSP
Function Important for the epidermal barrier integrity.
Tissue Specificity Exclusively expressed in skin.
Reactome Pathway
Formation of the cornified envelope (R-HSA-6809371 )

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Colonic neoplasm DISSZ04P Definitive Altered Expression [1]
Advanced cancer DISAT1Z9 Strong Altered Expression [2]
Alopecia DIS37HU4 Strong Genetic Variation [3]
Alzheimer disease DISF8S70 Strong Biomarker [4]
Behcet disease DISSYMBS Strong Genetic Variation [5]
Bipolar disorder DISAM7J2 Strong Altered Expression [6]
Breast neoplasm DISNGJLM Strong Biomarker [7]
Coagulation defect DIS9X3H6 Strong Biomarker [8]
Gastroenteritis DISXQCG5 Strong Biomarker [9]
Graves disease DISU4KOQ Strong Genetic Variation [10]
Hepatitis DISXXX35 Strong Biomarker [11]
Hepatitis A virus infection DISUMFQV Strong Biomarker [11]
Hepatitis B virus infection DISLQ2XY Strong Biomarker [12]
Hepatitis C virus infection DISQ0M8R Strong Biomarker [13]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [14]
Hereditary spastic paraplegia DISGZQV1 Strong Genetic Variation [15]
High blood pressure DISY2OHH Strong Biomarker [16]
Hypotrichosis 2 DIS1JN13 Strong Autosomal dominant [17]
Influenza DIS3PNU3 Strong Biomarker [18]
Leukodystrophy DISVY1TT Strong Genetic Variation [19]
Metastatic malignant neoplasm DIS86UK6 Strong Biomarker [7]
Middle East Respiratory Syndrome (MERS) DIS5VPYU Strong Genetic Variation [20]
Mood disorder DISLVMWO Strong Genetic Variation [21]
Multiple sclerosis DISB2WZI Strong Genetic Variation [22]
Osteoarthritis DIS05URM Strong Altered Expression [23]
Peeling skin syndrome 1 DIS35574 Strong Autosomal recessive [24]
Potocki-Shaffer syndrome DISKGU59 Strong Genetic Variation [25]
Severe acute respiratory syndrome (SARS) DISYW14W Strong Biomarker [26]
Systemic sclerosis DISF44L6 Strong Genetic Variation [25]
Thyroid gland carcinoma DISMNGZ0 Strong Biomarker [27]
Adult glioblastoma DISVP4LU moderate Altered Expression [28]
Asthma DISW9QNS moderate Genetic Variation [29]
Encephalitis DISLD1RL moderate Biomarker [30]
Encephalitis/encephalopathy, mild, with reversible myelin vacuolization DIS4VEZH moderate Genetic Variation [20]
Glioblastoma multiforme DISK8246 moderate Altered Expression [28]
Immune system disorder DISAEGPH moderate Altered Expression [31]
Leigh syndrome DISWQU45 moderate Biomarker [32]
Myopathy DISOWG27 moderate Altered Expression [31]
Hypotrichosis simplex of the scalp DISE73OD Supportive Autosomal dominant [17]
Skin disease DISDW8R6 Disputed Genetic Variation [33]
Ebola virus infection DISJAVM1 Limited Genetic Variation [34]
Glaucoma/ocular hypertension DISLBXBY Limited Altered Expression [35]
Hypotrichosis simplex DIS8WHDJ Limited Genetic Variation [33]
Lateral meningocele syndrome DISG74RP Limited Biomarker [36]
Limb-mammary syndrome DIS7H4FP Limited Biomarker [36]
Neoplasm DISZKGEW Limited Biomarker [12]
Rheumatoid arthritis DISTSB4J Limited Altered Expression [37]
Squamous cell carcinoma DISQVIFL Limited Biomarker [38]
------------------------------------------------------------------------------------
⏷ Show the Full List of 48 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Corneodesmosin (CDSN). [39]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Corneodesmosin (CDSN). [40]
Hydroquinone DM6AVR4 Approved Hydroquinone increases the expression of Corneodesmosin (CDSN). [41]
Amphotericin B DMTAJQE Approved Amphotericin B increases the expression of Corneodesmosin (CDSN). [42]
Ibuprofen DM8VCBE Approved Ibuprofen affects the expression of Corneodesmosin (CDSN). [43]
Rofecoxib DM3P5DA Approved Rofecoxib affects the expression of Corneodesmosin (CDSN). [43]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Corneodesmosin (CDSN). [44]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 Down's syndrome-associated single minded gene as a novel tumor marker.Anticancer Res. 2002 Nov-Dec;22(6A):3149-57.
2 S100A4 alters metabolism and promotes invasion of lung cancer cells by up-regulating mitochondrial complex I protein NDUFS2.J Biol Chem. 2019 May 3;294(18):7516-7527. doi: 10.1074/jbc.RA118.004365. Epub 2019 Mar 18.
3 A new amyloidosis caused by fibrillar aggregates of mutated corneodesmosin.FASEB J. 2010 Sep;24(9):3416-26. doi: 10.1096/fj.10-155622. Epub 2010 May 6.
4 Shifts in gut microbiota composition in an APP/PSS1 transgenic mouse model of Alzheimer's disease during lifespan.Lett Appl Microbiol. 2018 Jun;66(6):464-471. doi: 10.1111/lam.12882. Epub 2018 Apr 16.
5 Identification of a susceptibility locus in STAT4 for Behet's disease in Han Chinese in a genome-wide association study.Arthritis Rheum. 2012 Dec;64(12):4104-13. doi: 10.1002/art.37708.
6 Stimulatory G-protein alpha-subunit mRNA levels are not increased in autopsied cerebral cortex from patients with bipolar disorder.Brain Res Mol Brain Res. 1996 Nov;42(1):45-50. doi: 10.1016/s0169-328x(96)00112-x.
7 ADAM12 transmembrane and secreted isoforms promote breast tumor growth: a distinct role for ADAM12-S protein in tumor metastasis.J Biol Chem. 2011 Jun 10;286(23):20758-68. doi: 10.1074/jbc.M110.216036. Epub 2011 Apr 14.
8 Thrombophilia and varicella zoster in children.Hematology. 2013 Mar;18(2):119-22. doi: 10.1179/1607845412Y.0000000055. Epub 2013 Jan 3.
9 Immune responses induced by recombinant Lactobacillus plantarum expressing the spike protein derived from transmissible gastroenteritis virus in piglets.Appl Microbiol Biotechnol. 2018 Oct;102(19):8403-8417. doi: 10.1007/s00253-018-9205-0. Epub 2018 Jul 18.
10 Identification of independent risk loci for Graves' disease within the MHC in the Japanese population.J Hum Genet. 2011 Nov;56(11):772-8. doi: 10.1038/jhg.2011.99. Epub 2011 Sep 8.
11 Chimeric coronavirus-like particles carrying severe acute respiratory syndrome coronavirus (SCoV) S protein protect mice against challenge with SCoV.Vaccine. 2008 Feb 6;26(6):797-808. doi: 10.1016/j.vaccine.2007.11.092. Epub 2007 Dec 26.
12 A nonsense mutant of the hepatitis B virus large S protein antagonizes multiple tumor suppressor pathways through c-Jun activation domain-binding protein1.PLoS One. 2019 Mar 14;14(3):e0208665. doi: 10.1371/journal.pone.0208665. eCollection 2019.
13 Hepatitis C Virus core+1/ARF Protein Modulates the Cyclin D1/pRb Pathway and Promotes Carcinogenesis.J Virol. 2018 Apr 13;92(9):e02036-17. doi: 10.1128/JVI.02036-17. Print 2018 May 1.
14 Nucleotide change of codon 182 in the surface gene of hepatitis B virus genotype C leading to truncated surface protein is associated with progression of liver diseases.J Hepatol. 2012 Jan;56(1):63-9. doi: 10.1016/j.jhep.2011.06.028. Epub 2011 Aug 7.
15 Fe/S protein assembly gene IBA57 mutation causes hereditary spastic paraplegia. Neurology. 2015 Feb 17;84(7):659-67. doi: 10.1212/WNL.0000000000001270. Epub 2015 Jan 21.
16 Association of GNAS1 gene variant with hypertension depending on smoking status.Hypertension. 2002 Sep;40(3):261-5. doi: 10.1161/01.hyp.0000028490.77489.0c.
17 Hypotrichosis simplex of the scalp is associated with nonsense mutations in CDSN encoding corneodesmosin. Nat Genet. 2003 Jun;34(2):151-3. doi: 10.1038/ng1163.
18 The SARS-CoV Fusion Peptide Forms an Extended Bipartite Fusion Platform that Perturbs Membrane Order in a Calcium-Dependent Manner.J Mol Biol. 2017 Dec 8;429(24):3875-3892. doi: 10.1016/j.jmb.2017.10.017. Epub 2017 Oct 19.
19 Mutation of the iron-sulfur cluster assembly gene IBA57 causes fatal infantile leukodystrophy.J Inherit Metab Dis. 2015 Nov;38(6):1147-53. doi: 10.1007/s10545-015-9857-1. Epub 2015 May 14.
20 Mutations in the Spike Protein of Middle East Respiratory Syndrome Coronavirus Transmitted in Korea Increase Resistance to Antibody-Mediated Neutralization.J Virol. 2019 Jan 4;93(2):e01381-18. doi: 10.1128/JVI.01381-18. Print 2019 Jan 15.
21 Beta-1-adrenergic receptor gene in major depression: influence on antidepressant treatment response.Am J Med Genet B Neuropsychiatr Genet. 2003 Jul 1;120B(1):85-9. doi: 10.1002/ajmg.b.20017.
22 Risk alleles for multiple sclerosis identified by a genomewide study.N Engl J Med. 2007 Aug 30;357(9):851-62. doi: 10.1056/NEJMoa073493. Epub 2007 Jul 29.
23 Comparison of cathepsins K and S expression within the rheumatoid and osteoarthritic synovium.Arthritis Rheum. 2002 Mar;46(3):663-74. doi: 10.1002/art.10114.
24 The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
25 Inflammatory peeling skin syndrome caused a novel mutation in CDSN.Arch Dermatol Res. 2012 Apr;304(3):251-5. doi: 10.1007/s00403-011-1195-z. Epub 2011 Dec 7.
26 Identification and application of self-binding zipper-like sequences in SARS-CoV spike protein.Int J Biochem Cell Biol. 2018 Aug;101:103-112. doi: 10.1016/j.biocel.2018.05.012. Epub 2018 May 22.
27 Activating mutations of the TSH receptor in differentiated thyroid carcinomas.Oncogene. 1995 Nov 2;11(9):1907-11.
28 Intersectin1-S, a multidomain adapter protein, is essential for malignant glioma proliferation.Glia. 2015 Sep;63(9):1595-605. doi: 10.1002/glia.22830. Epub 2015 Apr 2.
29 Identification of Four Novel Loci in Asthma in European American and African American Populations.Am J Respir Crit Care Med. 2017 Feb 15;195(4):456-463. doi: 10.1164/rccm.201604-0861OC.
30 Novel treatment with neuroprotective and antiviral properties against a neuroinvasive human respiratory virus.J Virol. 2014 Feb;88(3):1548-63. doi: 10.1128/JVI.02972-13. Epub 2013 Nov 13.
31 X-linked vacuolated myopathy: membrane attack complex deposition on the surface membrane of injured muscle fibers is not accompanied by S-protein.Muscle Nerve. 1998 Jul;21(7):932-5. doi: 10.1002/(sici)1097-4598(199807)21:7<932::aid-mus11>3.0.co;2-s.
32 Succination is Increased on Select Proteins in the Brainstem of the NADH dehydrogenase (ubiquinone) Fe-S protein 4 (Ndufs4) Knockout Mouse, a Model of Leigh Syndrome.Mol Cell Proteomics. 2016 Feb;15(2):445-61. doi: 10.1074/mcp.M115.051516. Epub 2015 Oct 8.
33 Mutations in the CDSN gene cause peeling skin disease and hypotrichosis simplex of the scalp.J Dermatol. 2020 Jan;47(1):3-7. doi: 10.1111/1346-8138.15136. Epub 2019 Oct 29.
34 Identification of H209 as Essential for pH 8-Triggered Receptor-Independent Syncytium Formation by S Protein of Mouse Hepatitis Virus A59.J Virol. 2018 May 14;92(11):e00209-18. doi: 10.1128/JVI.00209-18. Print 2018 Jun 1.
35 The WldS gene delays axonal but not somatic degeneration in a rat glaucoma model.Eur J Neurosci. 2008 Sep;28(6):1166-79. doi: 10.1111/j.1460-9568.2008.06426.x. Epub 2008 Sep 9.
36 Lenz-Majewski mutations in PTDSS1 affect phosphatidylinositol 4-phosphate metabolism at ER-PM and ER-Golgi junctions.Proc Natl Acad Sci U S A. 2016 Apr 19;113(16):4314-9. doi: 10.1073/pnas.1525719113. Epub 2016 Apr 4.
37 PSORS1C1 may be involved in rheumatoid arthritis.Immunol Lett. 2013 Jun;153(1-2):9-14. doi: 10.1016/j.imlet.2013.06.001. Epub 2013 Jun 14.
38 Transcriptomic analysis to affirm the regulatory role of long non-coding RNA in horn cancer of Indian zebu cattle breed Kankrej (Bos indicus).Funct Integr Genomics. 2020 Jan;20(1):75-87. doi: 10.1007/s10142-019-00700-4. Epub 2019 Jul 31.
39 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
40 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
41 Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
42 Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
43 Rofecoxib modulates multiple gene expression pathways in a clinical model of acute inflammatory pain. Pain. 2007 Mar;128(1-2):136-47.
44 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.