Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRHED17)

• DOT Name: Endothelial protein C receptor (PROCR)
• Synonyms: Activated protein C receptor; APC receptor; Endothelial cell protein C receptor; CD antigen CD201
• Gene Name: PROCR
• Related Disease:
  Acute kidney injury
  Advanced cancer
  Neoplasm
  Adult glioblastoma
  Anemia
  Arteriosclerosis
  Arthritis
  Atherosclerosis
  Breast cancer
  Breast carcinoma
  Cardiovascular disease
  Coronary heart disease
  Gastric cancer
  Glioblastoma multiforme
  Haemophilia A
  Hemophilia
  Hepatocellular carcinoma
  Lung cancer
  Lung carcinoma
  Lupus
  Malaria
  Pneumonia
  Pneumonitis
  Pulmonary embolism
  Retinopathy
  Stomach cancer
  Streptococcal pneumonia
  Stroke
  Systemic lupus erythematosus
  Thrombophilia
  Thrombosis
  Triple negative breast cancer
  Vascular disease
  Adult respiratory distress syndrome
  Coronary atherosclerosis
  Ulcerative colitis
  Tuberculosis
  Asthma
  Carotid stenosis
  Epithelial ovarian cancer
  Malignant pleural mesothelioma
  Mesothelioma
  Myocardial infarction
  Non-insulin dependent diabetes
  Ovarian cancer
  Ovarian neoplasm
  Parkinson disease
• UniProt ID: EPCR_HUMAN
• PDB ID: 1L8J; 1LQV; 3JTC; 4V3D; 4V3E; 6SNY; 7OKS; 7OKT; 7OKU; 7OKV; 7Q5D; 8C44
• Pfam ID: PF16497
• Sequence:
  MLTTLLPILLLSGWAFCSQDASDGLQRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEG
  PDTNTTIIQLQPLQEPESWARTQSGLQSYLLQFHGLVRLVHQERTLAFPLTIRCFLGCEL
  PPEGSRAHVFFEVAVNGSSFVSFRPERALWQADTQVTSGVVTFTLQQLNAYNRTRYELRE
  FLEDTCVQYVQKHISAENTKGSQTSRSYTSLVLGVLVGSFIIAGVAVGIFLCTGGRRC
• Function: Binds activated protein C. Enhances protein C activation by the thrombin-thrombomodulin complex; plays a role in the protein C pathway controlling blood coagulation.
• Tissue Specificity: Expressed strongly in the endothelial cells of arteries and veins in heart and lung, less intensely in capillaries in the lung and skin, and not at all in the endothelium of small vessels of the liver and kidney.
• KEGG Pathway: Complement and coagulation cascades (hsa04610)
• Reactome Pathway:
  Cell surface interactions at the vascular wall (R-HSA-202733)
  Common Pathway of Fibrin Clot Formation (R-HSA-140875)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute kidney injury	DISXZG0T	Definitive	Therapeutic	[1]
Advanced cancer	DISAT1Z9	Definitive	Biomarker	[2]
Neoplasm	DISZKGEW	Definitive	Biomarker	[2]
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[3]
Anemia	DISTVL0C	Strong	Biomarker	[4]
Arteriosclerosis	DISK5QGC	Strong	Genetic Variation	[5]
Arthritis	DIST1YEL	Strong	Biomarker	[6]
Atherosclerosis	DISMN9J3	Strong	Genetic Variation	[5]
Breast cancer	DIS7DPX1	Strong	Biomarker	[2]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[7]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[8]
Coronary heart disease	DIS5OIP1	Strong	Genetic Variation	[9]
Gastric cancer	DISXGOUK	Strong	Biomarker	[10]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[3]
Haemophilia A	DIS0RQ2E	Strong	Altered Expression	[11]
Hemophilia	DIS1S8P6	Strong	Altered Expression	[11]
Hepatocellular carcinoma	DIS0J828	Strong	Genetic Variation	[12]
Lung cancer	DISCM4YA	Strong	Biomarker	[13]
Lung carcinoma	DISTR26C	Strong	Biomarker	[13]
Lupus	DISOKJWA	Strong	Biomarker	[14]
Malaria	DISQ9Y50	Strong	Genetic Variation	[15]
Pneumonia	DIS8EF3M	Strong	Biomarker	[16]
Pneumonitis	DIS88E0K	Strong	Biomarker	[16]
Pulmonary embolism	DISJYP9B	Strong	Genetic Variation	[17]
Retinopathy	DISB4B0F	Strong	Altered Expression	[18]
Stomach cancer	DISKIJSX	Strong	Biomarker	[10]
Streptococcal pneumonia	DIS2EKMJ	Strong	Biomarker	[19]
Stroke	DISX6UHX	Strong	Genetic Variation	[20]
Systemic lupus erythematosus	DISI1SZ7	Strong	Genetic Variation	[14]
Thrombophilia	DISQR7U7	Strong	Altered Expression	[21]
Thrombosis	DIS2TXP8	Strong	Genetic Variation	[22]
Triple negative breast cancer	DISAMG6N	Strong	Biomarker	[2]
Vascular disease	DISVS67S	Strong	Biomarker	[14]
Adult respiratory distress syndrome	DISIJV47	moderate	Altered Expression	[23]
Coronary atherosclerosis	DISKNDYU	moderate	Biomarker	[5]
Ulcerative colitis	DIS8K27O	moderate	Genetic Variation	[24]
Tuberculosis	DIS2YIMD	Disputed	Altered Expression	[25]
Asthma	DISW9QNS	Limited	Genetic Variation	[26]
Carotid stenosis	DISZA8D0	Limited	Biomarker	[27]
Epithelial ovarian cancer	DIS56MH2	Limited	Biomarker	[28]
Malignant pleural mesothelioma	DIST2R60	Limited	Biomarker	[29]
Mesothelioma	DISKWK9M	Limited	Biomarker	[30]
Myocardial infarction	DIS655KI	Limited	Genetic Variation	[31]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Altered Expression	[32]
Ovarian cancer	DISZJHAP	Limited	Biomarker	[28]
Ovarian neoplasm	DISEAFTY	Limited	Biomarker	[28]
Parkinson disease	DISQVHKL	Limited	Biomarker	[33]

20 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Endothelial protein C receptor (PROCR).	[34]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Endothelial protein C receptor (PROCR).	[35]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Endothelial protein C receptor (PROCR).	[36]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Endothelial protein C receptor (PROCR).	[37]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Endothelial protein C receptor (PROCR).	[38]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Endothelial protein C receptor (PROCR).	[39]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Endothelial protein C receptor (PROCR).	[40]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Endothelial protein C receptor (PROCR).	[42]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Endothelial protein C receptor (PROCR).	[43]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Endothelial protein C receptor (PROCR).	[44]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Endothelial protein C receptor (PROCR).	[45]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Endothelial protein C receptor (PROCR).	[46]
Etoposide	DMNH3PG	Approved	Etoposide increases the expression of Endothelial protein C receptor (PROCR).	[47]
Cyclophosphamide	DM4O2Z7	Approved	Cyclophosphamide increases the expression of Endothelial protein C receptor (PROCR).	[47]
Dactinomycin	DM2YGNW	Approved	Dactinomycin increases the expression of Endothelial protein C receptor (PROCR).	[47]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Endothelial protein C receptor (PROCR).	[48]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of Endothelial protein C receptor (PROCR).	[49]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Endothelial protein C receptor (PROCR).	[35]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Endothelial protein C receptor (PROCR).	[50]
Butanoic acid	DMTAJP7	Investigative	Butanoic acid increases the expression of Endothelial protein C receptor (PROCR).	[51]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Endothelial protein C receptor (PROCR).	[41]

References

• [1] Heme oxygenase 1 modulates thrombomodulin and endothelial protein C receptor levels to attenuate septic kidney injury.Shock. 2013 Aug;40(2):136-43. doi: 10.1097/SHK.0b013e31829d23f5.
• [2] Protein C receptor is a therapeutic stem cell target in a distinct group of breast cancers.Cell Res. 2019 Oct;29(10):832-845. doi: 10.1038/s41422-019-0225-9. Epub 2019 Sep 3.
• [3] Quantitative mRNA expression of genes involved in angiogenesis, coagulation and inflammation in multiforme glioblastoma tumoral tissue versus peritumoral brain tissue: lack of correlation with clinical data.Eur Cytokine Netw. 2012 Jun;23(2):45-55. doi: 10.1684/ecn.2012.0302.
• [4] Severe malaria: update on pathophysiology and treatment.Curr Opin Infect Dis. 2019 Oct;32(5):413-418. doi: 10.1097/QCO.0000000000000584.
• [5] Fifteen new risk loci for coronary artery disease highlight arterial-wall-specific mechanisms.Nat Genet. 2017 Jul;49(7):1113-1119. doi: 10.1038/ng.3874. Epub 2017 May 22.
• [6] Activated protein C targets immune cells and rheumatoid synovial fibroblasts to prevent inflammatory arthritis in mice.Rheumatology (Oxford). 2019 Oct 1;58(10):1850-1860. doi: 10.1093/rheumatology/key429.
• [7] EPCR promotes breast cancer progression by altering SPOCK1/testican 1-mediated 3D growth.J Hematol Oncol. 2017 Jan 19;10(1):23. doi: 10.1186/s13045-017-0399-x.
• [8] Astragaloside IV inhibits PMA-induced EPCR shedding through MAPKs and PKC pathway.Immunopharmacol Immunotoxicol. 2017 Jun;39(3):148-156. doi: 10.1080/08923973.2017.1306868. Epub 2017 Apr 3.
• [9] Identification of 64 Novel Genetic Loci Provides an Expanded View on the Genetic Architecture of Coronary Artery Disease.Circ Res. 2018 Feb 2;122(3):433-443. doi: 10.1161/CIRCRESAHA.117.312086. Epub 2017 Dec 6.
• [10] Endothelial cell protein C receptor promotes MGC803 gastric cancer cells proliferation and migration by activating ERK1/2.Med Oncol. 2015 May;32(5):162. doi: 10.1007/s12032-015-0614-y. Epub 2015 Apr 21.
• [11] Factor VIIa interaction with EPCR modulates the hemostatic effect of rFVIIa in hemophilia therapy: Mode of its action.Blood Adv. 2017 Jun 27;1(15):1206-1214. doi: 10.1182/bloodadvances.2016004143.
• [12] Effects of EZH2 polymorphisms on susceptibility to and pathological development of hepatocellular carcinoma.PLoS One. 2013 Sep 10;8(9):e74870. doi: 10.1371/journal.pone.0074870. eCollection 2013.
• [13] Inhibition of cellular growth and migration by suppression of endothelial protein C receptor (EPCR) in lung carcinoma cells.Oncol Res. 2012;20(5-6):231-40. doi: 10.3727/096504013x13589503482932.
• [14] Shedding of endothelial protein C receptor contributes to vasculopathy and renal injury in lupus: in vivo and in vitro evidence.Kidney Int. 2005 Jul;68(1):110-20. doi: 10.1111/j.1523-1755.2005.00385.x.
• [15] Controlled human malaria infection with Plasmodium falciparum demonstrates impact of naturally acquired immunity on virulence gene expression.PLoS Pathog. 2019 Jul 11;15(7):e1007906. doi: 10.1371/journal.ppat.1007906. eCollection 2019 Jul.
• [16] Host's Endogenous Caveolin-1 Expression is Downregulated in the Lung During Sepsis to Promote Cytoprotection.Shock. 2018 Aug;50(2):199-208. doi: 10.1097/SHK.0000000000001005.
• [17] Genome-wide association analysis of self-reported events in 6135 individuals and 252 827 controls identifies 8 loci associated with thrombosis.Hum Mol Genet. 2016 May 1;25(9):1867-74. doi: 10.1093/hmg/ddw037. Epub 2016 Feb 9.
• [18] Plasmodium falciparum EPCR-binding PfEMP1 expression increases with malaria disease severity and is elevated in retinopathy negative cerebral malaria.BMC Med. 2017 Oct 13;15(1):183. doi: 10.1186/s12916-017-0945-y.
• [19] An early increase in endothelial protein C receptor is associated with excess mortality in pneumococcal pneumonia with septic shock in the ICU.Crit Care. 2018 Oct 5;22(1):251. doi: 10.1186/s13054-018-2179-6.
• [20] Genetics of the thrombomodulin-endothelial cell protein C receptor system and the risk of early-onset ischemic stroke.PLoS One. 2018 Nov 1;13(11):e0206554. doi: 10.1371/journal.pone.0206554. eCollection 2018.
• [21] Extracellular Vesicle Characteristics in -thalassemia as Potential Biomarkers for Spleen Functional Status and Ineffective Erythropoiesis.Front Physiol. 2018 Aug 30;9:1214. doi: 10.3389/fphys.2018.01214. eCollection 2018.
• [22] Polymorphisms in the endothelial protein C receptor gene and thrombophilia.Thromb Haemost. 2007 Sep;98(3):564-9.
• [23] Dysregulation of pulmonary endothelial protein C receptor and thrombomodulin in severe falciparum malaria-associated ARDS relevant to hemozoin.PLoS One. 2017 Jul 21;12(7):e0181674. doi: 10.1371/journal.pone.0181674. eCollection 2017.
• [24] Association analyses identify 38 susceptibility loci for inflammatory bowel disease and highlight shared genetic risk across populations.Nat Genet. 2015 Sep;47(9):979-986. doi: 10.1038/ng.3359. Epub 2015 Jul 20.
• [25] The endothelial protein C receptor and activated protein C play a limited role in host defense during experimental tuberculosis.Thromb Haemost. 2013 Apr;109(4):726-37. doi: 10.1160/TH12-11-0859. Epub 2013 Jan 24.
• [26] Polymorphisms and haplotypes of the chromosome locus 17q12-17q21.1 contribute to adult asthma susceptibility in Slovenian patients.Hum Immunol. 2016 Jun;77(6):527-34. doi: 10.1016/j.humimm.2016.05.003. Epub 2016 May 6.
• [27] Genome-wide microarray analyses identify the protein C receptor as a novel calcineurin/nuclear factor of activated T cells-dependent gene in vascular smooth muscle cell phenotypic modulation.Arterioscler Thromb Vasc Biol. 2011 Nov;31(11):2665-75. doi: 10.1161/ATVBAHA.111.235960.
• [28] Plasma endothelial protein C receptor influences innate immune response in ovarian cancer by decreasing the population of natural killer and TH17 helper cells.Int J Oncol. 2013 Oct;43(4):1011-8. doi: 10.3892/ijo.2013.2021. Epub 2013 Jul 18.
• [29] Intrapleural Adenoviral-mediated Endothelial Cell Protein C Receptor Gene Transfer Suppresses the Progression of Malignant Pleural Mesothelioma in a Mouse Model.Sci Rep. 2016 Nov 11;6:36829. doi: 10.1038/srep36829.
• [30] Endothelial cell protein C receptor opposes mesothelioma growth driven by tissue factor.Cancer Res. 2013 Jul 1;73(13):3963-73. doi: 10.1158/0008-5472.CAN-12-1690. Epub 2013 Mar 28.
• [31] Endothelial protein C receptor polymorphisms and risk of myocardial infarction.Haematologica. 2008 Sep;93(9):1358-63. doi: 10.3324/haematol.13066.
• [32] EPCR Ser219Gly: elevated sEPCR, prothrombin F1+2, risk for coronary heart disease, and increased sEPCR shedding in vitro.Atherosclerosis. 2005 Dec;183(2):283-92. doi: 10.1016/j.atherosclerosis.2005.02.028.
• [33] MPTP/MPP+ suppresses activation of protein C in Parkinson's disease.J Alzheimers Dis. 2015;43(1):133-42. doi: 10.3233/JAD-140126.
• [34] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [35] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [36] Effects of the chemotherapeutic agent doxorubicin on the protein C anticoagulant pathway. Mol Cancer Ther. 2006 Dec;5(12):3303-11. doi: 10.1158/1535-7163.MCT-06-0154.
• [37] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [38] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [39] Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
• [40] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [41] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [42] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [43] Gene microarray analysis of human renal cell carcinoma: the effects of HDAC inhibition and retinoid treatment. Cancer Biol Ther. 2008 Oct;7(10):1607-18.
• [44] Gene expression profiling of rheumatoid arthritis synovial cells treated with antirheumatic drugs. J Biomol Screen. 2007 Apr;12(3):328-40. doi: 10.1177/1087057107299261. Epub 2007 Mar 22.
• [45] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [46] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [47] Genomic profiling uncovers a molecular pattern for toxicological characterization of mutagens and promutagens in vitro. Toxicol Sci. 2011 Jul;122(1):185-97.
• [48] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [49] Anti-inflammatory effects of methylthiouracil in vitro and in vivo. Toxicol Appl Pharmacol. 2015 Nov 1;288(3):374-86. doi: 10.1016/j.taap.2015.08.009. Epub 2015 Aug 20.
• [50] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [51] MS4A3-HSP27 target pathway reveals potential for haematopoietic disorder treatment in alimentary toxic aleukia. Cell Biol Toxicol. 2023 Feb;39(1):201-216. doi: 10.1007/s10565-021-09639-4. Epub 2021 Sep 28.