Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTT6D5MH)

• DOT Name: Cofilin-1 (CFL1)
• Synonyms: 18 kDa phosphoprotein; p18; Cofilin, non-muscle isoform
• Gene Name: CFL1
• Related Disease:
  Anal intraepithelial neoplasia
  Glioma
  Melanoma
  Meningioma
  Neuroblastoma
  Pancreatic cancer
  Acute lymphocytic leukaemia
  Adenocarcinoma
  Adult lymphoma
  Alzheimer disease
  Bladder cancer
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Childhood acute lymphoblastic leukemia
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Diabetic kidney disease
  Endometriosis
  Erectile dysfunction
  Esophageal squamous cell carcinoma
  Hepatocellular carcinoma
  Lung carcinoma
  Lymphoma
  Myelodysplastic syndrome
  Nephrotic syndrome
  Neuralgia
  Non-small-cell lung cancer
  Pediatric lymphoma
  Prostate cancer
  Prostate carcinoma
  Retinoblastoma
  Status epilepticus seizure
  Urinary bladder cancer
  Urinary bladder neoplasm
  West syndrome
  Lung cancer
  Metastatic malignant neoplasm
  Vitamin B12 deficiency
  Psoriatic arthritis
  Myocardial infarction
  Plasma cell myeloma
  Precancerous condition
  Psoriasis
• UniProt ID: COF1_HUMAN
• PDB ID: 1Q8G; 1Q8X; 3J0S; 4BEX; 5HVK; 5L6W; 6UBY; 6UC0; 6UC4; 6VAO
• Pfam ID: PF00241
• Sequence:
  MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV
  GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS
  KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL
• Function: Binds to F-actin and exhibits pH-sensitive F-actin depolymerizing activity. In conjunction with the subcortical maternal complex (SCMC), plays an essential role for zygotes to progress beyond the first embryonic cell divisions via regulation of actin dynamics. Required for the centralization of the mitotic spindle and symmetric division of zygotes. Plays a role in the regulation of cell morphology and cytoskeletal organization in epithelial cells. Required for the up-regulation of atypical chemokine receptor ACKR2 from endosomal compartment to cell membrane, increasing its efficiency in chemokine uptake and degradation. Required for neural tube morphogenesis and neural crest cell migration.
• Tissue Specificity: Widely distributed in various tissues.
• KEGG Pathway:
  Axon guidance (hsa04360)
  Fc gamma R-mediated phagocytosis (hsa04666)
  Regulation of actin cytoskeleton (hsa04810)
  Pertussis (hsa05133)
  Human immunodeficiency virus 1 infection (hsa05170)
• Reactome Pathway:
  Regulation of actin dynamics for phagocytic cup formation (R-HSA-2029482)
  EPHB-mediated forward signaling (R-HSA-3928662)
  Sema3A PAK dependent Axon repulsion (R-HSA-399954)
  RHO GTPases Activate ROCKs (R-HSA-5627117)
  Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation (R-HSA-8950505)
  Platelet degranulation (R-HSA-114608)

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Anal intraepithelial neoplasia	DISJ0JW3	Definitive	Altered Expression	[1]
Glioma	DIS5RPEH	Definitive	Altered Expression	[2]
Melanoma	DIS1RRCY	Definitive	Biomarker	[3]
Meningioma	DISPT4TG	Definitive	Genetic Variation	[4]
Neuroblastoma	DISVZBI4	Definitive	Biomarker	[5]
Pancreatic cancer	DISJC981	Definitive	Altered Expression	[1]
Acute lymphocytic leukaemia	DISPX75S	Strong	Genetic Variation	[6]
Adenocarcinoma	DIS3IHTY	Strong	Biomarker	[7]
Adult lymphoma	DISK8IZR	Strong	Biomarker	[8]
Alzheimer disease	DISF8S70	Strong	Biomarker	[9]
Bladder cancer	DISUHNM0	Strong	Altered Expression	[10]
Breast cancer	DIS7DPX1	Strong	Biomarker	[11]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[11]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[12]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Strong	Genetic Variation	[6]
Colon cancer	DISVC52G	Strong	Biomarker	[13]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[13]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[14]
Diabetic kidney disease	DISJMWEY	Strong	Biomarker	[15]
Endometriosis	DISX1AG8	Strong	Biomarker	[16]
Erectile dysfunction	DISD8MTH	Strong	Therapeutic	[17]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[18]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[19]
Lung carcinoma	DISTR26C	Strong	Biomarker	[20]
Lymphoma	DISN6V4S	Strong	Biomarker	[8]
Myelodysplastic syndrome	DISYHNUI	Strong	Biomarker	[21]
Nephrotic syndrome	DISSPSC2	Strong	Therapeutic	[22]
Neuralgia	DISWO58J	Strong	Therapeutic	[23]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[7]
Pediatric lymphoma	DIS51BK2	Strong	Biomarker	[8]
Prostate cancer	DISF190Y	Strong	Biomarker	[24]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[24]
Retinoblastoma	DISVPNPB	Strong	Biomarker	[25]
Status epilepticus seizure	DISY3BIC	Strong	Genetic Variation	[26]
Urinary bladder cancer	DISDV4T7	Strong	Altered Expression	[10]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[10]
West syndrome	DISLIAU9	Strong	Biomarker	[27]
Lung cancer	DISCM4YA	moderate	Biomarker	[20]
Metastatic malignant neoplasm	DIS86UK6	moderate	Altered Expression	[28]
Vitamin B12 deficiency	DIS91UJ1	moderate	Biomarker	[29]
Psoriatic arthritis	DISLWTG2	Disputed	Biomarker	[30]
Myocardial infarction	DIS655KI	Limited	Therapeutic	[31]
Plasma cell myeloma	DIS0DFZ0	Limited	Biomarker	[32]
Precancerous condition	DISV06FL	Limited	Biomarker	[33]
Psoriasis	DIS59VMN	Limited	Genetic Variation	[34]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	Cofilin-1 (CFL1) affects the binding of 4-hydroxy-2-nonenal.	[64]

26 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Cofilin-1 (CFL1).	[35]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Cofilin-1 (CFL1).	[36]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Cofilin-1 (CFL1).	[37]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Cofilin-1 (CFL1).	[38]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Cofilin-1 (CFL1).	[39]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of Cofilin-1 (CFL1).	[40]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Cofilin-1 (CFL1).	[41]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Cofilin-1 (CFL1).	[42]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Cofilin-1 (CFL1).	[43]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Cofilin-1 (CFL1).	[44]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Cofilin-1 (CFL1).	[45]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Cofilin-1 (CFL1).	[46]
Haloperidol	DM96SE0	Approved	Haloperidol increases the expression of Cofilin-1 (CFL1).	[47]
Dopamine	DMPGUCF	Approved	Dopamine increases the expression of Cofilin-1 (CFL1).	[49]
Etretinate	DM2CZFA	Approved	Etretinate decreases the expression of Cofilin-1 (CFL1).	[50]
Ximelegatran	DMU8ANS	Approved	Ximelegatran decreases the expression of Cofilin-1 (CFL1).	[51]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Cofilin-1 (CFL1).	[52]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Cofilin-1 (CFL1).	[53]
Undecylenic acid derivative 1	DMLJ2HE	Patented	Undecylenic acid derivative 1 increases the expression of Cofilin-1 (CFL1).	[46]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Cofilin-1 (CFL1).	[56]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Cofilin-1 (CFL1).	[57]
Butanoic acid	DMTAJP7	Investigative	Butanoic acid decreases the expression of Cofilin-1 (CFL1).	[59]
Okadaic acid	DM47CO1	Investigative	Okadaic acid increases the expression of Cofilin-1 (CFL1).	[60]
	DM9CEI5		increases the expression of Cofilin-1 (CFL1).	[61]
Myricetin	DMTV4L0	Investigative	Myricetin increases the expression of Cofilin-1 (CFL1).	[62]
Fasudil	DMTCNOM	Investigative	Fasudil decreases the expression of Cofilin-1 (CFL1).	[63]

2 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Dihydroartemisinin	DMBXVMZ	Approved	Dihydroartemisinin affects the binding of Cofilin-1 (CFL1).	[48]
D-glucose	DMMG2TO	Investigative	D-glucose increases the secretion of Cofilin-1 (CFL1).	[58]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Cofilin-1 (CFL1).	[54]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Cofilin-1 (CFL1).	[55]

References

• [1] Expression of UGP2 and CFL1 expression levels in benign and malignant pancreatic lesions and their clinicopathological significance.World J Surg Oncol. 2018 Jan 18;16(1):11. doi: 10.1186/s12957-018-1316-7.
• [2] Cofilin-1 and phosphoglycerate kinase 1 as promising indicators for glioma radiosensibility and prognosis.Oncotarget. 2017 Jul 5;8(33):55073-55083. doi: 10.18632/oncotarget.19025. eCollection 2017 Aug 15.
• [3] Potential predictive value of cofilin-1 for metastasis occurrence in a small cohort of Argentinian patients with mid-low Breslow thickness melanoma.Pathol Res Pract. 2019 Oct;215(10):152582. doi: 10.1016/j.prp.2019.152582. Epub 2019 Aug 8.
• [4] Molecular analysis of alterations of the p18INK4c gene in human meningiomas.Neuropathol Appl Neurobiol. 2000 Feb;26(1):67-75. doi: 10.1046/j.1365-2990.2000.00219.x.
• [5] Genome-wide pathway analysis in neuroblastoma.Tumour Biol. 2014 Apr;35(4):3471-85. doi: 10.1007/s13277-013-1459-7. Epub 2013 Nov 30.
• [6] Homozygous deletions of cyclin-dependent kinase inhibitor genes, p16(INK4A) and p18, in childhood T cell lineage acute lymphoblastic leukemias.Leukemia. 1996 Feb;10(2):255-60.
• [7] Comparison of cofilin? and Twist? protein expression in human nonsmall cell lung cancer tissues.Oncol Rep. 2019 Aug;42(2):805-816. doi: 10.3892/or.2019.7193. Epub 2019 Jun 10.
• [8] Analysis of the novel cyclin-dependent kinase 4 and 6 inhibitor gene p18 in lymphoma and leukemia cell lines.Leuk Res. 1996 Feb;20(2):197-200. doi: 10.1016/0145-2126(95)00137-9.
• [9] Microglial motility in Alzheimer's disease and after A42 immunotherapy: a human post-mortem study.Acta Neuropathol Commun. 2019 Nov 8;7(1):174. doi: 10.1186/s40478-019-0828-x.
• [10] miR-182-5p affects human bladder cancer cell proliferation, migration and invasion through regulating Cofilin 1.Cancer Cell Int. 2019 Feb 28;19:42. doi: 10.1186/s12935-019-0758-5. eCollection 2019.
• [11] MiR-519d-3p suppresses breast cancer cell growth and motility via targeting LIM domain kinase 1.Mol Cell Biochem. 2018 Jul;444(1-2):169-178. doi: 10.1007/s11010-017-3241-4. Epub 2017 Nov 29.
• [12] Glycolytic cancer associated fibroblasts promote breast cancer tumor growth, without a measurable increase in angiogenesis: evidence for stromal-epithelial metabolic coupling.Cell Cycle. 2010 Jun 15;9(12):2412-22. doi: 10.4161/cc.9.12.11989. Epub 2010 Jun 15.
• [13] Differential involvement of destrin and cofilin-1 in the control of invasive properties of Isreco1 human colon cancer cells.Int J Cancer. 2007 Nov 15;121(10):2162-71. doi: 10.1002/ijc.22911.
• [14] Cofilin-1 signaling mediates epithelial-mesenchymal transition by promoting actin cytoskeleton reorganization and cell-cell adhesion regulation in colorectal cancer cells.Biochim Biophys Acta Mol Cell Res. 2019 Mar;1866(3):418-429. doi: 10.1016/j.bbamcr.2018.10.003. Epub 2018 Oct 5.
• [15] Ezrin is down-regulated in diabetic kidney glomeruli and regulates actin reorganization and glucose uptake via GLUT1 in cultured podocytes.Am J Pathol. 2014 Jun;184(6):1727-39. doi: 10.1016/j.ajpath.2014.03.002. Epub 2014 Apr 13.
• [16] Silencing Cofilin-1 blocks PDGF-induced proliferation in eutopic endometrium of endometriosis patients.Cell Biol Int. 2013 Aug;37(8):799-804. doi: 10.1002/cbin.10093. Epub 2013 Apr 11.
• [17] Restoration of erectile function by suppression of corporal apoptosis, fibrosis and corporal veno-occlusive dysfunction with rho-kinase inhibitors in a rat model of cavernous nerve injury.J Urol. 2015 May;193(5):1716-23. doi: 10.1016/j.juro.2014.10.099. Epub 2014 Oct 27.
• [18] Using proteomic approach to identify tumor-associated proteins as biomarkers in human esophageal squamous cell carcinoma.J Proteome Res. 2011 Jun 3;10(6):2863-72. doi: 10.1021/pr200141c. Epub 2011 May 3.
• [19] Evaluating the role of RAD52 and its interactors as novel potential molecular targets for hepatocellular carcinoma.Cancer Cell Int. 2019 Nov 6;19:279. doi: 10.1186/s12935-019-0996-6. eCollection 2019.
• [20] Detection of sputum cofilin-1 as indicator of malignancy.Braz J Med Biol Res. 2018;51(8):e7138. doi: 10.1590/1414-431x20187138. Epub 2018 May 28.
• [21] Hematopathological alterations of major tumor suppressor cascade, vital cell cycle inhibitors and hematopoietic niche components in experimental myelodysplasia.Chem Biol Interact. 2017 Aug 1;273:1-10. doi: 10.1016/j.cbi.2017.05.014. Epub 2017 May 23.
• [22] Cyclosporine A protects podocytes via stabilization of cofilin-1 expression in the unphosphorylated state.Exp Biol Med (Maywood). 2014 Aug;239(8):922-936. doi: 10.1177/1535370214530365. Epub 2014 Apr 15.
• [23] Simvastatin Attenuates Neuropathic Pain by Inhibiting the RhoA/LIMK/Cofilin Pathway.Neurochem Res. 2016 Sep;41(9):2457-69. doi: 10.1007/s11064-016-1958-1. Epub 2016 May 23.
• [24] Ursolic acid activates the apoptosis of prostate cancer via ROCK/PTEN mediated mitochondrial translocation of cofilin-1.Oncol Lett. 2018 Mar;15(3):3202-3206. doi: 10.3892/ol.2017.7689. Epub 2017 Dec 27.
• [25] The effect of miR-340 over-expression on cell-cycle-related genes in triple-negative breast cancer cells.Eur J Cancer Care (Engl). 2017 Nov;26(6). doi: 10.1111/ecc.12496. Epub 2016 May 27.
• [26] Interaction of GABA(A) and GABA(B) antagonists after status epilepticus in immature rats.Epilepsy Behav. 2020 Jan;102:106683. doi: 10.1016/j.yebeh.2019.106683. Epub 2019 Nov 21.
• [27] Proteomic analysis on infantile spasm and prenatal stress.Epilepsy Res. 2014 Sep;108(7):1174-83. doi: 10.1016/j.eplepsyres.2014.06.001. Epub 2014 Jun 14.
• [28] Phosphorylation of cofilin-1 by ERK confers HDAC inhibitor resistance in hepatocellular carcinoma cells via decreased ROS-mediated mitochondria injury.Oncogene. 2017 Apr 6;36(14):1978-1990. doi: 10.1038/onc.2016.357. Epub 2016 Oct 17.
• [29] Maternal micronutrient deficiency leads to alteration in the kidney proteome in rat pups.J Proteomics. 2015 Sep 8;127(Pt A):178-84. doi: 10.1016/j.jprot.2015.04.035. Epub 2015 May 14.
• [30] "Invivo self-assembled" nanoprobes for optimizing autophagy-mediated chemotherapy.Biomaterials. 2017 Oct;141:199-209. doi: 10.1016/j.biomaterials.2017.06.042. Epub 2017 Jun 30.
• [31] Membrane ER attenuates myocardial fibrosis via RhoA/ROCK-mediated actin remodeling in ovariectomized female infarcted rats.J Mol Med (Berl). 2014 Jan;92(1):43-51. doi: 10.1007/s00109-013-1103-4. Epub 2013 Nov 29.
• [32] Frequent inactivation of the cyclin-dependent kinase inhibitor p18 by homozygous deletion in multiple myeloma cell lines: ectopic p18 expression inhibits growth and induces apoptosis.Leukemia. 2002 Jan;16(1):127-34. doi: 10.1038/sj.leu.2402328.
• [33] Hepatocellular carcinoma-associated protein markers investigated by MALDI-TOF MS.Mol Med Rep. 2010 Jul-Aug;3(4):589-96. doi: 10.3892/mmr_00000302.
• [34] Large scale meta-analysis characterizes genetic architecture for common psoriasis associated variants.Nat Commun. 2017 May 24;8:15382. doi: 10.1038/ncomms15382.
• [35] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [36] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [37] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [38] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [39] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [40] Inorganic arsenic exposure promotes malignant progression by HDAC6-mediated down-regulation of HTRA1. J Appl Toxicol. 2023 Aug;43(8):1214-1224. doi: 10.1002/jat.4457. Epub 2023 Mar 11.
• [41] Differential protein expression of peroxiredoxin I and II by benzo(a)pyrene and quercetin treatment in 22Rv1 and PrEC prostate cell lines. Toxicol Appl Pharmacol. 2007 Apr 15;220(2):197-210. doi: 10.1016/j.taap.2006.12.030. Epub 2007 Jan 9.
• [42] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [43] Proteomic and functional analyses reveal a dual molecular mechanism underlying arsenic-induced apoptosis in human multiple myeloma cells. J Proteome Res. 2009 Jun;8(6):3006-19.
• [44] Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
• [45] Zoledronate dysregulates fatty acid metabolism in renal tubular epithelial cells to induce nephrotoxicity. Arch Toxicol. 2018 Jan;92(1):469-485.
• [46] Identification of potential biomarkers for predicting acute dermal irritation by proteomic analysis. J Appl Toxicol. 2011 Nov;31(8):762-72.
• [47] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [48] Untargeted Proteomics and Systems-Based Mechanistic Investigation of Artesunate in Human Bronchial Epithelial Cells. Chem Res Toxicol. 2015 Oct 19;28(10):1903-13. doi: 10.1021/acs.chemrestox.5b00105. Epub 2015 Sep 21.
• [49] Mitochondrial proteomics investigation of a cellular model of impaired dopamine homeostasis, an early step in Parkinson's disease pathogenesis. Mol Biosyst. 2014 Jun;10(6):1332-44.
• [50] Consequences of the natural retinoid/retinoid X receptor ligands action in human breast cancer MDA-MB-231 cell line: Focus on functional proteomics. Toxicol Lett. 2017 Nov 5;281:26-34. doi: 10.1016/j.toxlet.2017.09.001. Epub 2017 Sep 5.
• [51] Organized migration of epithelial cells requires control of adhesion and protrusion through Rho kinase effectors. Am J Physiol Gastrointest Liver Physiol. 2007 Mar;292(3):G806-17. doi: 10.1152/ajpgi.00333.2006. Epub 2006 Nov 30.
• [52] Proteomics analysis of human umbilical vein endothelial cells treated with resveratrol. Amino Acids. 2012 Oct;43(4):1671-8. doi: 10.1007/s00726-012-1248-4. Epub 2012 Feb 18.
• [53] Proteomic analysis of MCF-7 cells treated with benzo[a]pyrene, dibenzo[a,l]pyrene, coal tar extract, and diesel exhaust extract. Toxicology. 2008 Jul 10;249(1):1-10.
• [54] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [55] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [56] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [57] Molecular targets of chloropicrin in human airway epithelial cells. Toxicol In Vitro. 2017 Aug;42:247-254.
• [58] Calorie restriction-induced changes in the secretome of human adipocytes, comparison with resveratrol-induced secretome effects. Biochim Biophys Acta. 2014 Sep;1844(9):1511-22. doi: 10.1016/j.bbapap.2014.04.023. Epub 2014 May 5.
• [59] MS4A3-HSP27 target pathway reveals potential for haematopoietic disorder treatment in alimentary toxic aleukia. Cell Biol Toxicol. 2023 Feb;39(1):201-216. doi: 10.1007/s10565-021-09639-4. Epub 2021 Sep 28.
• [60] Proteomic analysis reveals multiple patterns of response in cells exposed to a toxin mixture. Chem Res Toxicol. 2009 Jun;22(6):1077-85.
• [61] A novel sialyltransferase inhibitor suppresses FAK/paxillin signaling and cancer angiogenesis and metastasis pathways. Cancer Res. 2011 Jan 15;71(2):473-83. doi: 10.1158/0008-5472.CAN-10-1303. Epub 2011 Jan 11.
• [62] Potential role of nucleoside diphosphate kinase in myricetin-induced selective apoptosis in colon cancer HCT-15?cells. Food Chem Toxicol. 2018 Jun;116(Pt B):315-322. doi: 10.1016/j.fct.2018.04.053. Epub 2018 Apr 24.
• [63] Allelic Variants in Arhgef11 via the Rho-Rock Pathway Are Linked to Epithelial-Mesenchymal Transition and Contributes to Kidney Injury in the Dahl Salt-Sensitive Rat. PLoS One. 2015 Jul 14;10(7):e0132553. doi: 10.1371/journal.pone.0132553. eCollection 2015.
• [64] Site-specific protein adducts of 4-hydroxy-2(E)-nonenal in human THP-1 monocytic cells: protein carbonylation is diminished by ascorbic acid. Chem Res Toxicol. 2010 Jan;23(1):37-47. doi: 10.1021/tx9002462.