Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTW8V2V1)

• DOT Name: Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2)
• Synonyms: EC 7.6.2.2; ATP-binding cassette sub-family G member 2; Breast cancer resistance protein; CDw338; Mitoxantrone resistance-associated protein; Placenta-specific ATP-binding cassette transporter; Urate exporter; CD antigen CD338
• Gene Name: ABCG2
• UniProt ID: ABCG2_HUMAN
• PDB ID: 5NJ3; 5NJG; 6ETI; 6FEQ; 6FFC; 6HBU; 6HCO; 6HIJ; 6HZM; 6VXF; 6VXH; 6VXI; 6VXJ; 7NEQ; 7NEZ; 7NFD; 7OJ8; 7OJH; 7OJI; 8BHT; 8BI0; 8P7W; 8P8A; 8P8J; 8U2C
• EC Number: 7.6.2.2
• Pfam ID: PF01061 ; PF19055 ; PF00005
• Sequence:
  MSSSNVEVFIPVSQGNTNGFPATASNDLKAFTEGAVLSFHNICYRVKLKSGFLPCRKPVE
  KEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDPSGLSGDVLINGAPRPANFKCN
  SGYVVQDDVVMGTLTVRENLQFSAALRLATTMTNHEKNERINRVIQELGLDKVADSKVGT
  QFIRGVSGGERKRTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIF
  SIHQPRYSIFKLFDSLTLLASGRLMFHGPAQEALGYFESAGYHCEAYNNPADFFLDIING
  DSTAVALNREEDFKATEIIEPSKQDKPLIEKLAEIYVNSSFYKETKAELHQLSGGEKKKK
  ITVFKEISYTTSFCHQLRWVSKRSFKNLLGNPQASIAQIIVTVVLGLVIGAIYFGLKNDS
  TGIQNRAGVLFFLTTNQCFSSVSAVELFVVEKKLFIHEYISGYYRVSSYFLGKLLSDLLP
  MRMLPSIIFTCIVYFMLGLKPKADAFFVMMFTLMMVAYSASSMALAIAAGQSVVSVATLL
  MTICFVFMMIFSGLLVNLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGN
  NPCNYATCTGEEYLVKQGIDLSPWGLWKNHVALACMIVIFLTIAYLKLLFLKKYS
• Function: Broad substrate specificity ATP-dependent transporter of the ATP-binding cassette (ABC) family that actively extrudes a wide variety of physiological compounds, dietary toxins and xenobiotics from cells. Involved in porphyrin homeostasis, mediating the export of protoporphyrin IX (PPIX) from both mitochondria to cytosol and cytosol to extracellular space, it also functions in the cellular export of heme. Also mediates the efflux of sphingosine-1-P from cells. Acts as a urate exporter functioning in both renal and extrarenal urate excretion. In kidney, it also functions as a physiological exporter of the uremic toxin indoxyl sulfate. Also involved in the excretion of steroids like estrone 3-sulfate/E1S, 3beta-sulfooxy-androst-5-en-17-one/DHEAS, and other sulfate conjugates. Mediates the secretion of the riboflavin and biotin vitamins into milk. Extrudes pheophorbide a, a phototoxic porphyrin catabolite of chlorophyll, reducing its bioavailability. Plays an important role in the exclusion of xenobiotics from the brain (Probable). It confers to cells a resistance to multiple drugs and other xenobiotics including mitoxantrone, pheophorbide, camptothecin, methotrexate, azidothymidine, and the anthracyclines daunorubicin and doxorubicin, through the control of their efflux. In placenta, it limits the penetration of drugs from the maternal plasma into the fetus. May play a role in early stem cell self-renewal by blocking differentiation.
• Tissue Specificity: Highly expressed in placenta . Low expression in small intestine, liver and colon . Expressed in brain (at protein level) .
• KEGG Pathway:
  Antifolate resistance (hsa01523)
  ABC transporters (hsa02010)
  Bile secretion (hsa04976)
• Reactome Pathway:
  Heme degradation (R-HSA-189483)
  Abacavir transmembrane transport (R-HSA-2161517)
  Iron uptake and transport (R-HSA-917937)
  Paracetamol ADME (R-HSA-9753281)
  Ciprofloxacin ADME (R-HSA-9793528)
  NFE2L2 regulating MDR associated enzymes (R-HSA-9818032)
  Heme biosynthesis (R-HSA-189451)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 12 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fulvestrant	DM0YZC6	Approved	Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2) affects the response to substance of Fulvestrant.	[71]
Aspirin	DM672AH	Approved	Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2) increases the Diarrhoea ADR of Aspirin.	[72]
Irinotecan	DMP6SC2	Approved	Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2) increases the response to substance of Irinotecan.	[73]
Topotecan	DMP6G8T	Approved	Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2) decreases the response to substance of Topotecan.	[74]
Gefitinib	DM15F0X	Approved	Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2) increases the Diarrhea ADR of Gefitinib.	[72]
Warfarin	DMJYCVW	Approved	Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2) affects the response to substance of Warfarin.	[76]
Nilotinib	DM7HXWT	Approved	Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2) affects the response to substance of Nilotinib.	[77]
Epirubicin	DMPDW6T	Approved	Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2) decreases the response to substance of Epirubicin.	[74]
Rosuvastatin	DMMIQ7G	Approved	Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2) increases the LDL cholesterol decreased ADR of Rosuvastatin.	[83]
Sunitinib	DMCBJSR	Approved	Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2) increases the Vomiting ADR of Sunitinib.	[84]
PHA-739358	DMGYBZI	Phase 2	Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2) decreases the response to substance of PHA-739358.	[87]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2) affects the response to substance of 3R14S-OCHRATOXIN A.	[88]

This DOT Affected the Biotransformations of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Adenosine triphosphate	DM79F6G	Approved	Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2) increases the hydrolysis of Adenosine triphosphate.	[75]

This DOT Affected the Regulation of Drug Effects of 12 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cimetidine	DMH61ZB	Approved	Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2) affects the transport of Cimetidine.	[36]
Pitavastatin	DMJH792	Approved	Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2) affects the transport of Pitavastatin.	[78]
Aciclovir	DMYLOVR	Approved	Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2) affects the transport of Aciclovir.	[79]
Nitrofurantoin	DM7PQIK	Approved	Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2) increases the transport of Nitrofurantoin.	[80]
Sulfapyridine	DMIUYFH	Approved	Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2) increases the transport of Sulfapyridine.	[81]
Sulpiride	DMF54ZG	Approved	Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2) increases the transport of Sulpiride.	[82]
Moxidectin	DMYGHX5	Approved	Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2) increases the export of Moxidectin .	[85]
CP-724714	DMUJ0W7	Phase 2	Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2) affects the transport of CP-724714.	[86]
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE	DMNQL17	Investigative	Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2) decreases the transport of 2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE.	[89]
Ginsenoside Re	DM46FVD	Investigative	Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2) increases the transport of Ginsenoside Re.	[90]
[3H]estrone-3-sulphate	DMGPF0N	Investigative	Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2) increases the export of [3H]estrone-3-sulphate.	[91]
[3H]estradiol-17beta-glucuronide	DM3KJ45	Investigative	Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2) increases the transport of [3H]estradiol-17beta-glucuronide.	[92]

91 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[6]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[7]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[8]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[9]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[10]
Testosterone	DM7HUNW	Approved	Testosterone decreases the activity of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[11]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[12]
Carbamazepine	DMZOLBI	Approved	Carbamazepine increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[13]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[14]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[15]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[16]
Phenobarbital	DMXZOCG	Approved	Phenobarbital increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[17]
Progesterone	DMUY35B	Approved	Progesterone decreases the activity of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[11]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[18]
Folic acid	DMEMBJC	Approved	Folic acid increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[19]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[20]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[21]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[22]
Paclitaxel	DMLB81S	Approved	Paclitaxel decreases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[23]
Permethrin	DMZ0Q1G	Approved	Permethrin decreases the activity of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[24]
Rifampicin	DM5DSFZ	Approved	Rifampicin increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[17]
Mitoxantrone	DMM39BF	Approved	Mitoxantrone increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[25]
Zidovudine	DM4KI7O	Approved	Zidovudine increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[26]
Daunorubicin	DMQUSBT	Approved	Daunorubicin increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[27]
Lindane	DMB8CNL	Approved	Lindane increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[28]
Imatinib	DM7RJXL	Approved	Imatinib increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[29]
Estrone	DM5T6US	Approved	Estrone increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[7]
Crizotinib	DM4F29C	Approved	Crizotinib decreases the activity of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[30]
Ciprofloxacin XR	DM2NLS9	Approved	Ciprofloxacin XR increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[31]
Omeprazole	DM471KJ	Approved	Omeprazole increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[20]
Estriol	DMOEM2I	Approved	Estriol increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[7]
Romidepsin	DMT5GNL	Approved	Romidepsin affects the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[15]
Nelfinavir mesylate	DMFX6G8	Approved	Nelfinavir mesylate decreases the activity of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[32]
LY2835219	DM93VBZ	Approved	LY2835219 decreases the activity of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[33]
Naproxen	DMZ5RGV	Approved	Naproxen affects the activity of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[34]
Methoxsalen	DME8FZ9	Approved	Methoxsalen increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[35]
Digoxin	DMQCTIH	Approved	Digoxin decreases the activity of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[36]
Dabrafenib	DMX6OE3	Approved	Dabrafenib increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[37]
Novobiocin	DMRFWGK	Approved	Novobiocin decreases the activity of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[39]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[40]
Beclomethasone dipropionate	DM5NW1E	Phase 4	Beclomethasone dipropionate increases the activity of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[41]
Silymarin	DMXBYQR	Phase 4	Silymarin increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[42]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[43]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[44]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[45]
Chloroquine	DMSI5CB	Phase 3 Trial	Chloroquine decreases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[46]
I3C	DMIGFOR	Phase 3	I3C increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[42]
5-methoxypsoralen	DME2A8X	Phase 3	5-methoxypsoralen increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[35]
MLN8237	DMO8PT9	Phase 3	MLN8237 affects the activity of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[47]
TAK-875	DMIM5AP	Phase 3	TAK-875 decreases the activity of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[48]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[49]
ANW-32821	DMMJOZD	Phase 2	ANW-32821 increases the activity of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[50]
Pyrethroids	DM1794O	Phase 2	Pyrethroids decreases the activity of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[24]
Oxfendazole	DMSNL51	Phase 2	Oxfendazole decreases the activity of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[51]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[53]
PMID26394986-Compound-22	DM43Z1G	Patented	PMID26394986-Compound-22 decreases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[54]
Flavonoid derivative 1	DMCQP0B	Patented	Flavonoid derivative 1 affects the activity of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[55]
PMID26560530-Compound-34	DMLGZPO	Patented	PMID26560530-Compound-34 increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[17]
Elacridar	DMURVE8	Discontinued in Phase 1	Elacridar decreases the activity of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[56]
Nimesulide	DMR1NMD	Terminated	Nimesulide decreases the activity of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[34]
WIN-55212-2	DMACBIW	Terminated	WIN-55212-2 affects the activity of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[57]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[58]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[59]
Butanoic acid	DMTAJP7	Investigative	Butanoic acid increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[60]
Forskolin	DM6ITNG	Investigative	Forskolin increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[61]
Okadaic acid	DM47CO1	Investigative	Okadaic acid increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[62]
Chlorpyrifos	DMKPUI6	Investigative	Chlorpyrifos increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[63]
CH-223191	DMMJZYC	Investigative	CH-223191 decreases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[64]
Chrysin	DM7V2LG	Investigative	Chrysin decreases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[65]
CATECHIN	DMY38SB	Investigative	CATECHIN decreases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[42]
AM251	DMTAWHL	Investigative	AM251 increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[66]
Oleic acid	DM54O1Z	Investigative	Oleic acid increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[67]
2-tert-butylbenzene-1,4-diol	DMNXI1E	Investigative	2-tert-butylbenzene-1,4-diol increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[42]
N-nonylphenol	DMH3OUX	Investigative	N-nonylphenol decreases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[58]
Flavone	DMEQH6J	Investigative	Flavone increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[42]
Chlorphrifos oxon	DMGBT68	Investigative	Chlorphrifos oxon increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[68]
Ginsenoside RG3	DMFN58T	Investigative	Ginsenoside RG3 decreases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[69]
Anandamide	DMCKH3P	Investigative	Anandamide decreases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[70]
4-ANDROSTENE-3-17-DIONE	DMSE8NU	Investigative	4-ANDROSTENE-3-17-DIONE decreases the activity of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[11]
chlordane	DMMHU8G	Investigative	chlordane increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[28]
(11-BETA)-11,21-DIHYDROXY-PREGN-4-ENE-3,20-DIONE	DMTPQ84	Investigative	(11-BETA)-11,21-DIHYDROXY-PREGN-4-ENE-3,20-DIONE decreases the activity of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[36]
2-chloro-5-nitro-N-phenylbenzamide	DMUGQIV	Investigative	2-chloro-5-nitro-N-phenylbenzamide affects the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[68]
6-bromoindirubin-3-oxime	DM12WYV	Investigative	6-bromoindirubin-3-oxime increases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[8]
T0070907	DMTKSVO	Investigative	T0070907 decreases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[21]
Racemic DOI	DM39FSQ	Investigative	Racemic DOI increases the activity of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[57]
CID16020046	DMLWZRT	Investigative	CID16020046 decreases the expression of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[66]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Sulfasalazine	DMICA9H	Approved	Sulfasalazine decreases the methylation of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[27]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[52]

3 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Venetoclax	DM8I94Y	Approved	Venetoclax affects the binding of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[38]
Pibrentasvir	DM27BL1	Approved	Pibrentasvir affects the binding of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[38]
GS-5885	DMSL3DX	Phase 2	GS-5885 affects the binding of Broad substrate specificity ATP-binding cassette transporter ABCG2 (ABCG2).	[38]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [3] All-trans retinoic acid enhances the transport of phase II metabolites of benzo[a]pyrene by inducing the Breast Cancer Resistance Protein expression in Caco-2 cells. Toxicol Lett. 2010 Aug 16;197(2):151-5. doi: 10.1016/j.toxlet.2010.05.018. Epub 2010 Jun 1.
• [4] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [5] Single-step doxorubicin-selected cancer cells overexpress the ABCG2 drug transporter through epigenetic changes. Br J Cancer. 2008 May 6;98(9):1515-24.
• [6] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [7] Effects of sex hormones on regulation of ABCG2 expression in the placental cell line BeWo. J Pharm Pharm Sci. 2006;9(1):133-9.
• [8] Activation of beta-catenin signalling by GSK-3 inhibition increases p-glycoprotein expression in brain endothelial cells. J Neurochem. 2008 Aug;106(4):1855-65. doi: 10.1111/j.1471-4159.2008.05537.x. Epub 2008 Jul 4.
• [9] Arsenic trioxide induces differentiation of cancer stem cells in hepatocellular carcinoma through inhibition of LIF/JAK1/STAT3 and NF-kB signaling pathways synergistically. Clin Transl Med. 2021 Feb;11(2):e335. doi: 10.1002/ctm2.335.
• [10] Chronic Oxidative Stress Increases Resistance to Doxorubicin-Induced Cytotoxicity in Renal Carcinoma Cells Potentially Through Epigenetic Mechanism. Mol Pharmacol. 2016 Jan;89(1):27-41. doi: 10.1124/mol.115.100206. Epub 2015 Oct 30.
• [11] Localization of breast cancer resistance protein (Bcrp) in endocrine organs and inhibition of its transport activity by steroid hormones. Cell Tissue Res. 2012 Aug;349(2):551-63. doi: 10.1007/s00441-012-1417-5. Epub 2012 May 13.
• [12] Triclosan treatment decreased the antitumor effect of sorafenib on hepatocellular carcinoma cells. Onco Targets Ther. 2018 May 18;11:2945-2954.
• [13] Transcriptional profiling of genes induced in the livers of patients treated with carbamazepine. Clin Pharmacol Ther. 2006 Nov;80(5):440-456.
• [14] Proteomic identification of differentially expressed proteins associated with the multiple drug resistance in methotrexate-resistant human breast cancer cells. Int J Oncol. 2014 Jul;45(1):448-58.
• [15] Aberrant promoter methylation of the ABCG2 gene in renal carcinoma. Mol Cell Biol. 2006 Nov;26(22):8572-85.
• [16] In vitro evaluation of zoledronic acid resistance developed in MCF-7 cells. Anticancer Res. 2007 Nov-Dec;27(6B):4031-7.
• [17] Differential regulation of sinusoidal and canalicular hepatic drug transporter expression by xenobiotics activating drug-sensing receptors in primary human hepatocytes. Drug Metab Dispos. 2006 Oct;34(10):1756-63. doi: 10.1124/dmd.106.010033. Epub 2006 Jul 12.
• [18] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [19] Folate deprivation induces BCRP (ABCG2) expression and mitoxantrone resistance in Caco-2 cells. Int J Cancer. 2008 Oct 1;123(7):1712-20.
• [20] A novel xenobiotic responsive element regulated by aryl hydrocarbon receptor is involved in the induction of BCRP/ABCG2 in LS174T cells. Biochem Pharmacol. 2010 Dec 1;80(11):1754-61.
• [21] Regulation of the placental BCRP transporter by PPAR gamma. J Biochem Mol Toxicol. 2017 May;31(5):10.1002/jbt.21880. doi: 10.1002/jbt.21880. Epub 2016 Nov 23.
• [22] Prenatal ethanol exposure increases maternal bile acids through placental transport pathway. Toxicology. 2021 Jun 30;458:152848. doi: 10.1016/j.tox.2021.152848. Epub 2021 Jul 2.
• [23] FaDu cell characteristics induced by multidrug resistance. Oncol Rep. 2011 Nov;26(5):1189-95. doi: 10.3892/or.2011.1418. Epub 2011 Aug 10.
• [24] Inhibition of human MDR1 and BCRP transporter ATPase activity by organochlorine and pyrethroid insecticides. J Biochem Mol Toxicol. 2013 Feb;27(2):157-64.
• [25] Enhanced in vitro invasiveness and drug resistance with altered gene expression patterns in a human lung carcinoma cell line after pulse selection with anticancer drugs. Int J Cancer. 2004 Sep 10;111(4):484-93. doi: 10.1002/ijc.20230.
• [26] Differential gene expression in human hepatocyte cell lines exposed to the antiretroviral agent zidovudine. Arch Toxicol. 2014 Mar;88(3):609-23. doi: 10.1007/s00204-013-1169-3. Epub 2013 Nov 30.
• [27] Chemotherapeutic drug-induced ABCG2 promoter demethylation as a novel mechanism of acquired multidrug resistance. Neoplasia. 2009 Dec;11(12):1359-70. doi: 10.1593/neo.91314.
• [28] Regulation of hepatic drug transporter activity and expression by organochlorine pesticides. J Biochem Mol Toxicol. 2014 Mar;28(3):119-28.
• [29] Chronic imatinib mesylate exposure leads to reduced intracellular drug accumulation by induction of the ABCG2 (BCRP) and ABCB1 (MDR1) drug transport pumps. Cancer Biol Ther. 2005 Jul;4(7):747-52.
• [30] Editor's Highlight: PlacentalDisposition and Effects of Crizotinib: An Ex Vivo Study in the Isolated Dual-Side Perfused Human Cotyledon. Toxicol Sci. 2017 Jun 1;157(2):500-509. doi: 10.1093/toxsci/kfx063.
• [31] Ciprofloxacin mediates cancer stem cell phenotypes in lung cancer cells through caveolin-1-dependent mechanism. Chem Biol Interact. 2016 Apr 25;250:1-11.
• [32] Influence of ABCB1, ABCC1, ABCC2, and ABCG2 haplotypes on the cellular exposure of nelfinavir in vivo. Pharmacogenet Genomics. 2005 Sep;15(9):599-608. doi: 10.1097/01.fpc.0000172241.42546.d3.
• [33] Effect of abemaciclib (LY2835219) on enhancement of chemotherapeutic agents in ABCB1 and ABCG2 overexpressing cells in vitro and in vivo. Biochem Pharmacol. 2017 Jan 15;124:29-42. doi: 10.1016/j.bcp.2016.10.015. Epub 2016 Nov 2.
• [34] Cyclooxygenase inhibitors down regulate P-glycoprotein in human colorectal Caco-2 cell line. Pharm Res. 2008 Sep;25(9):1991-2001. doi: 10.1007/s11095-008-9596-1. Epub 2008 Jun 26.
• [35] ABC-transporter blockage mediated by xanthotoxin and bergapten is the major pathway for chemosensitization of multidrug-resistant cancer cells. Toxicol Appl Pharmacol. 2017 Dec 15;337:22-29. doi: 10.1016/j.taap.2017.10.018. Epub 2017 Oct 25.
• [36] Human breast cancer resistance protein: interactions with steroid drugs, hormones, the dietary carcinogen 2-amino-1-methyl-6-phenylimidazo(4,5-b)pyridine, and transport of cimetidine. J Pharmacol Exp Ther. 2005 Jan;312(1):144-52. doi: 10.1124/jpet.104.073916. Epub 2004 Sep 13.
• [37] Dabrafenib inhibits ABCG2 and cytochrome P450 isoenzymes; potential implications for combination anticancer therapy. Toxicol Appl Pharmacol. 2022 Jan 1;434:115797. doi: 10.1016/j.taap.2021.115797. Epub 2021 Nov 13.
• [38] Prospective Drug Candidates as Human Multidrug Transporter ABCG2 Inhibitors: an In Silico Drug Discovery Study. Cell Biochem Biophys. 2021 Jun;79(2):189-200. doi: 10.1007/s12013-021-00985-y. Epub 2021 May 5.
• [39] Interactions between Oroxylin A with the solute carrier transporters and ATP-binding cassette transporters: Drug transporters profile for this flavonoid. Chem Biol Interact. 2020 Jun 1;324:109097. doi: 10.1016/j.cbi.2020.109097. Epub 2020 Apr 16.
• [40] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [41] Modulation of p-glycoprotein and breast cancer resistance protein by some prescribed corticosteroids. Eur J Pharmacol. 2006 Feb 15;531(1-3):25-33. doi: 10.1016/j.ejphar.2005.12.010. Epub 2006 Jan 25.
• [42] Phytochemicals induce breast cancer resistance protein in Caco-2 cells and enhance the transport of benzo[a]pyrene-3-sulfate. Toxicol Sci. 2007 Apr;96(2):227-36. doi: 10.1093/toxsci/kfl147. Epub 2006 Oct 31.
• [43] Resveratrol inhibits pancreatic cancer stem cell characteristics in human and KrasG12D transgenic mice by inhibiting pluripotency maintaining factors and epithelial-mesenchymal transition. PLoS One. 2011 Jan 31;6(1):e16530. doi: 10.1371/journal.pone.0016530.
• [44] Impact of epigallocatechin gallate on gene expression profiles of human hepatocellular carcinoma cell lines BEL7404/ADM and BEL7402/5-FU. Ai Zheng. 2008 Oct;27(10):1056-64.
• [45] Curcumin suppresses the stemness of non-small cell lung cancer cells via promoting the nuclear-cytoplasm translocation of TAZ. Environ Toxicol. 2021 Jun;36(6):1135-1142. doi: 10.1002/tox.23112. Epub 2021 Feb 4.
• [46] Autophagy inhibition upregulates CD4(+) tumor infiltrating lymphocyte expression via miR-155 regulation and TRAIL activation. Mol Oncol. 2016 Dec;10(10):1516-1531. doi: 10.1016/j.molonc.2016.08.005. Epub 2016 Sep 16.
• [47] Alisertib shows negligible potential for perpetrating pharmacokinetic drug-drug interactions on ABCB1, ABCG2 and cytochromes P450, but acts as dual-activity resistance modulator through the inhibition of ABCC1 transporter. Toxicol Appl Pharmacol. 2022 Jan 1;434:115823. doi: 10.1016/j.taap.2021.115823. Epub 2021 Dec 9.
• [48] Mechanistic investigations of the liver toxicity of the free fatty acid receptor 1 agonist fasiglifam (TAK875) and its primary metabolites. J Biochem Mol Toxicol. 2019 Aug;33(8):e22345. doi: 10.1002/jbt.22345. Epub 2019 May 8.
• [49] Genetic and Dietary Regulation of Glyburide Efflux by the Human Placental Breast Cancer Resistance Protein Transporter. J Pharmacol Exp Ther. 2016 Apr;357(1):103-13.
• [50] Functional characterization of rainbow trout (Oncorhynchus mykiss) Abcg2a (Bcrp) transporter. Comp Biochem Physiol C Toxicol Pharmacol. 2016 Dec;190:15-23. doi: 10.1016/j.cbpc.2016.07.005. Epub 2016 Jul 27.
• [51] Transport of anthelmintic benzimidazole drugs by breast cancer resistance protein (BCRP/ABCG2). Drug Metab Dispos. 2005 May;33(5):614-8.
• [52] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [53] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [54] Differential effects of selective cyclooxygenase-2 inhibitors in inhibiting proliferation and induction of apoptosis in oral squamous cell carcinoma. Oncol Rep. 2008 Feb;19(2):425-33.
• [55] Luteolin enhances the bioavailability of benzo(a)pyrene in human colon carcinoma cells. Arch Biochem Biophys. 2010 Jun 15;498(2):111-8. doi: 10.1016/j.abb.2010.04.009. Epub 2010 Apr 18.
• [56] Flavonoid structure-activity studies identify 6-prenylchrysin and tectochrysin as potent and specific inhibitors of breast cancer resistance protein ABCG2. Cancer Res. 2005 Jun 1;65(11):4852-60.
• [57] Inhibition and stimulation of the human breast cancer resistance protein as in vitro predictor of drug-drug interactions of drugs of abuse. Arch Toxicol. 2018 Sep;92(9):2875-2884. doi: 10.1007/s00204-018-2276-y. Epub 2018 Aug 6.
• [58] The xenoestrogens, bisphenol A and para-nonylphenol, decrease the expression of the ABCG2 transporter protein in human term placental explant cultures. Mol Cell Endocrinol. 2016 Jul 5;429:41-9. doi: 10.1016/j.mce.2016.03.034. Epub 2016 Mar 30.
• [59] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [60] Butyrate interacts with benzo[a]pyrene to alter expression and activities of xenobiotic metabolizing enzymes involved in metabolism of carcinogens within colon epithelial cell models. Toxicology. 2019 Jan 15;412:1-11.
• [61] Induction of cells differentiation and ABC transporters expression by a myco-estrogen, zearalenone, in human choriocarcinoma cell line (BeWo). Toxicology. 2009 Sep 19;263(2-3):100-7. doi: 10.1016/j.tox.2009.06.023. Epub 2009 Jul 4.
• [62] Comparison of long-term versus short-term effects of okadaic acid on the apoptotic status of human HepaRG cells. Chem Biol Interact. 2020 Feb 1;317:108937. doi: 10.1016/j.cbi.2020.108937. Epub 2020 Jan 8.
• [63] Chlorpyrifos modifies the expression of genes involved in human placental function. Reprod Toxicol. 2012 Jun;33(3):331-8. doi: 10.1016/j.reprotox.2012.01.003. Epub 2012 Jan 21.
• [64] The Ah receptor regulates growth factor expression in head and neck squamous cell carcinoma cell lines. Mol Carcinog. 2014 Oct;53(10):765-76.
• [65] Anti-inflammatory effects of dietary phenolic compounds in an in vitro model of inflamed human intestinal epithelium. Chem Biol Interact. 2010 Dec 5;188(3):659-67.
• [66] Selective GPR55 antagonism reduces chemoresistance in cancer cells. Pharmacol Res. 2016 Sep;111:757-766. doi: 10.1016/j.phrs.2016.07.013. Epub 2016 Jul 14.
• [67] Oleic acid decreases BCRP mediated efflux of mitoxantrone in Caco-2 cell monolayers. Food Chem Toxicol. 2012 Oct;50(10):3635-45.
• [68] Concentration-dependent effects of chlorpyrifos oxon on peroxisome proliferator-activated receptor signaling in MCF-7 cells. Toxicol In Vitro. 2022 Feb;78:105268. doi: 10.1016/j.tiv.2021.105268. Epub 2021 Oct 29.
• [69] Ginsenoside Rg3 attenuates the osimertinib resistance by reducing the stemness of non-small cell lung cancer cells. Environ Toxicol. 2020 Jun;35(6):643-651. doi: 10.1002/tox.22899. Epub 2020 Jan 9.
• [70] Anandamide down-regulates placental transporter expression through CB2 receptor-mediated inhibition of cAMP synthesis. Pharmacol Res. 2019 Mar;141:331-342. doi: 10.1016/j.phrs.2019.01.002. Epub 2019 Jan 2.
• [71] Fulvestrant induces resistance by modulating GPER and CDK6 expression: implication of methyltransferases, deacetylases and the hSWI/SNF chromatin remodelling complex. Br J Cancer. 2013 Nov 12;109(10):2751-62. doi: 10.1038/bjc.2013.583. Epub 2013 Oct 29.
• [72] Pharmacogenetics of ABCG2 and adverse reactions to gefitinib. J Natl Cancer Inst. 2006 Dec 6;98(23):1739-42.
• [73] Concise prediction models of anticancer efficacy of 8 drugs using expression data from 12 selected genes. Int J Cancer. 2004 Sep 10;111(4):617-26. doi: 10.1002/ijc.20289.
• [74] Camptothecin resistance: role of the ATP-binding cassette (ABC), mitoxantrone-resistance half-transporter (MXR), and potential for glucuronidation in MXR-expressing cells. Cancer Res. 1999 Dec 1;59(23):5938-46.
• [75] Lapatinib (Tykerb, GW572016) reverses multidrug resistance in cancer cells by inhibiting the activity of ATP-binding cassette subfamily B member 1 and G member 2. Cancer Res. 2008 Oct 1;68(19):7905-14. doi: 10.1158/0008-5472.CAN-08-0499.
• [76] Association between ABCG2 and ABCB1 genes and warfarin stability: a case-control study. Thromb Res. 2014 Dec;134(6):1359-62. doi: 10.1016/j.thromres.2014.09.017. Epub 2014 Sep 20.
• [77] Resistance to daunorubicin, imatinib, or nilotinib depends on expression levels of ABCB1 and ABCG2 in human leukemia cells. Chem Biol Interact. 2014 Aug 5;219:203-10. doi: 10.1016/j.cbi.2014.06.009. Epub 2014 Jun 19.
• [78] Involvement of BCRP (ABCG2) in the biliary excretion of pitavastatin. Mol Pharmacol. 2005 Sep;68(3):800-7.
• [79] Acyclovir is a substrate for the human breast cancer resistance protein (BCRP/ABCG2): implications for renal tubular transport and acyclovir-induced nephrotoxicity. Can J Physiol Pharmacol. 2011 Sep;89(9):675-80. doi: 10.1139/y11-045. Epub 2011 Aug 22.
• [80] Effects of the flavonoid chrysin on nitrofurantoin pharmacokinetics in rats: potential involvement of ABCG2. Drug Metab Dispos. 2007 Feb;35(2):268-74.
• [81] Pharmacogenetic characterization of sulfasalazine disposition based on NAT2 and ABCG2 (BCRP) gene polymorphisms in humans. Clin Pharmacol Ther. 2008 Jul;84(1):95-103.
• [82] Multiple drug transporters mediate the placental transport of sulpiride. Arch Toxicol. 2017 Dec;91(12):3873-3884. doi: 10.1007/s00204-017-2008-8. Epub 2017 Jun 9.
• [83] ABCG2 polymorphism is associated with the low-density lipoprotein cholesterol response to rosuvastatin. Clin Pharmacol Ther. 2010 May;87(5):558-62.
• [84] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
• [85] In vitro and in vivo interaction of moxidectin with BCRP/ABCG2. Chem Biol Interact. 2009 Jun 15;180(1):106-12. doi: 10.1016/j.cbi.2009.02.009. Epub 2009 Feb 23.
• [86] Role of hepatic transporters in the disposition and hepatotoxicity of a HER2 tyrosine kinase inhibitor CP-724,714. Toxicol Sci. 2009 Apr;108(2):492-500. doi: 10.1093/toxsci/kfp033. Epub 2009 Feb 17.
• [87] Abcg2 overexpression represents a novel mechanism for acquired resistance to the multi-kinase inhibitor Danusertib in BCR-ABL-positive cells in vitro. PLoS One. 2011 Apr 26;6(4):e19164. doi: 10.1371/journal.pone.0019164.
• [88] Ochratoxin A transport by the human breast cancer resistance protein (BCRP), multidrug resistance protein 2 (MRP2), and organic anion-transporting polypeptides 1A2, 1B1 and 2B1. Toxicol Appl Pharmacol. 2017 Aug 15;329:18-25. doi: 10.1016/j.taap.2017.05.022. Epub 2017 May 19.
• [89] Association of the ABCG2 C421A polymorphism with prostate cancer risk and survival. BJU Int. 2008 Dec;102(11):1694-9.
• [90] Molecular mechanisms governing different pharmacokinetics of ginsenosides and potential for ginsenoside-perpetrated herb-drug interactions on OATP1B3. Br J Pharmacol. 2015 Feb;172(4):1059-73. doi: 10.1111/bph.12971. Epub 2015 Jan 20.
• [91] Uremic toxins inhibit transport by breast cancer resistance protein and multidrug resistance protein 4 at clinically relevant concentrations. PLoS One. 2011 Apr 4;6(4):e18438. doi: 10.1371/journal.pone.0018438.
• [92] Inhibitory effects of terpenoids on multidrug resistance-associated protein 2- and breast cancer resistance protein-mediated transport. Drug Metab Dispos. 2008 Jul;36(7):1206-11.