Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWFQGX7)

DOT Name Prolactin (PRL)
Synonyms PRL
Gene Name PRL
UniProt ID
PRL_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1RW5; 2Q98; 3D48; 3EW3; 3MZG; 3N06; 3N0P; 3NCB; 3NCC; 3NCE; 3NCF; 3NPZ
Pfam ID
PF00103
Sequence
MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNL
SSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWN
EPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSG
LPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC
Function Prolactin acts primarily on the mammary gland by promoting lactation.
KEGG Pathway
Cytokine-cytokine receptor interaction (hsa04060 )
Neuroactive ligand-receptor interaction (hsa04080 )
PI3K-Akt sig.ling pathway (hsa04151 )
JAK-STAT sig.ling pathway (hsa04630 )
Prolactin sig.ling pathway (hsa04917 )
Reactome Pathway
Amyloid fiber formation (R-HSA-977225 )
Growth hormone receptor signaling (R-HSA-982772 )
Prolactin receptor signaling (R-HSA-1170546 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Regulation of Drug Effects of 4 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Testosterone DM7HUNW Approved Prolactin (PRL) decreases the abundance of Testosterone. [70]
Prasterone DM67VKL Approved Prolactin (PRL) increases the secretion of Prasterone. [71]
Dehydroepiandrosterone sulfate DM4Q80H Approved Prolactin (PRL) increases the abundance of Dehydroepiandrosterone sulfate. [72]
Dihydrotestosterone DM3S8XC Phase 4 Prolactin (PRL) decreases the abundance of Dihydrotestosterone. [72]
------------------------------------------------------------------------------------
66 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Prolactin (PRL). [1]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Prolactin (PRL). [2]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Prolactin (PRL). [3]
Arsenic DMTL2Y1 Approved Arsenic decreases the expression of Prolactin (PRL). [4]
Triclosan DMZUR4N Approved Triclosan increases the expression of Prolactin (PRL). [5]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Prolactin (PRL). [6]
Marinol DM70IK5 Approved Marinol decreases the expression of Prolactin (PRL). [7]
Progesterone DMUY35B Approved Progesterone increases the expression of Prolactin (PRL). [8]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of Prolactin (PRL). [10]
Cytarabine DMZD5QR Approved Cytarabine increases the expression of Prolactin (PRL). [2]
DTI-015 DMXZRW0 Approved DTI-015 decreases the expression of Prolactin (PRL). [14]
Cocaine DMSOX7I Approved Cocaine decreases the expression of Prolactin (PRL). [15]
Mifepristone DMGZQEF Approved Mifepristone increases the expression of Prolactin (PRL). [16]
Methamphetamine DMPM4SK Approved Methamphetamine affects the expression of Prolactin (PRL). [17]
Haloperidol DM96SE0 Approved Haloperidol increases the expression of Prolactin (PRL). [18]
Lindane DMB8CNL Approved Lindane increases the expression of Prolactin (PRL). [3]
Fluoxetine DM3PD2C Approved Fluoxetine increases the expression of Prolactin (PRL). [19]
Dopamine DMPGUCF Approved Dopamine decreases the expression of Prolactin (PRL). [20]
Olanzapine DMPFN6Y Approved Olanzapine increases the expression of Prolactin (PRL). [18]
Penicillamine DM40EF6 Approved Penicillamine increases the expression of Prolactin (PRL). [22]
Omeprazole DM471KJ Approved Omeprazole increases the expression of Prolactin (PRL). [23]
Cimetidine DMH61ZB Approved Cimetidine affects the expression of Prolactin (PRL). [24]
Thioridazine DM35M8J Approved Thioridazine increases the expression of Prolactin (PRL). [25]
Clomipramine DMINRKW Approved Clomipramine increases the expression of Prolactin (PRL). [26]
Citalopram DM2G9AE Approved Citalopram increases the expression of Prolactin (PRL). [27]
Clonidine DM6RZ9Q Approved Clonidine increases the expression of Prolactin (PRL). [28]
Levodopa DMN3E57 Approved Levodopa decreases the expression of Prolactin (PRL). [29]
Risperidone DMN6DXL Approved Risperidone increases the expression of Prolactin (PRL). [18]
Famotidine DMRL3AB Approved Famotidine increases the expression of Prolactin (PRL). [30]
Methadone DMTW6IU Approved Methadone increases the expression of Prolactin (PRL). [31]
Octreotide DMHIDCJ Approved Octreotide affects the expression of Prolactin (PRL). [32]
Bromocriptine DMVE3TK Approved Bromocriptine decreases the expression of Prolactin (PRL). [33]
Aripiprazole DM3NUMH Approved Aripiprazole decreases the expression of Prolactin (PRL). [34]
Trifluoperazine DMKBYWI Approved Trifluoperazine increases the expression of Prolactin (PRL). [35]
Naloxone DM3FXMA Approved Naloxone affects the expression of Prolactin (PRL). [37]
Domperidone DMBDPY0 Approved Domperidone increases the expression of Prolactin (PRL). [38]
Metoclopramide DMFA5MY Approved Metoclopramide increases the expression of Prolactin (PRL). [39]
Paliperidone DM7NPJS Approved Paliperidone increases the expression of Prolactin (PRL). [40]
Labetalol DMK8U72 Approved Labetalol increases the expression of Prolactin (PRL). [41]
Duloxetine DM9BI7M Approved Duloxetine increases the expression of Prolactin (PRL). [42]
L-tryptophan DMIBH7M Approved L-tryptophan increases the expression of Prolactin (PRL). [43]
Sulpiride DMF54ZG Approved Sulpiride increases the abundance of Prolactin (PRL). [45]
Methyldopa DM5I621 Approved Methyldopa increases the expression of Prolactin (PRL). [46]
Buspirone DMBS632 Approved Buspirone increases the expression of Prolactin (PRL). [47]
Mirtazapine DML53ZJ Approved Mirtazapine increases the expression of Prolactin (PRL). [48]
Pimozide DMW83TP Approved Pimozide increases the expression of Prolactin (PRL). [49]
Perphenazine DMA4MRX Approved Perphenazine increases the expression of Prolactin (PRL). [50]
Yohimbine DMJCP1Y Approved Yohimbine increases the expression of Prolactin (PRL). [51]
Cabergoline DMQ4HIN Approved Cabergoline decreases the expression of Prolactin (PRL). [52]
Amoxapine DMKITQE Approved Amoxapine increases the expression of Prolactin (PRL). [53]
Doxapram DMCYANK Approved Doxapram increases the expression of Prolactin (PRL). [55]
Zotepine DMF3VXA Approved Zotepine decreases the expression of Prolactin (PRL). [56]
Nalbuphine DMOSQGU Approved Nalbuphine increases the expression of Prolactin (PRL). [57]
Chlorpromazine DMBGZI3 Phase 3 Trial Chlorpromazine increases the expression of Prolactin (PRL). [58]
Fenfluramine DM0762O Phase 3 Fenfluramine increases the expression of Prolactin (PRL). [59]
Verapamil DMA7PEW Phase 2/3 Trial Verapamil increases the expression of Prolactin (PRL). [60]
BL-1020 DMVDO93 Phase 2 BL-1020 increases the expression of Prolactin (PRL). [61]
Terguride DMZNFPG Phase 2 Terguride decreases the expression of Prolactin (PRL). [62]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Prolactin (PRL). [63]
Manganese DMKT129 Investigative Manganese decreases the expression of Prolactin (PRL). [4]
Hydroxyestradiol DMJXQME Investigative Hydroxyestradiol increases the expression of Prolactin (PRL). [43]
2-hydroxy-17beta-estradiol DMM9Z0B Investigative 2-hydroxy-17beta-estradiol increases the expression of Prolactin (PRL). [43]
Apomorphine SL DMPH7EO Investigative Apomorphine SL decreases the expression of Prolactin (PRL). [66]
m-chlorophenylpiperazine DMM1J2D Investigative m-chlorophenylpiperazine increases the expression of Prolactin (PRL). [67]
Nalorphine DM1SCU5 Investigative Nalorphine increases the expression of Prolactin (PRL). [68]
ANALOG OF DYNORPHIN A DMYW5JX Investigative ANALOG OF DYNORPHIN A increases the expression of Prolactin (PRL). [69]
------------------------------------------------------------------------------------
⏷ Show the Full List of 66 Drug(s)
10 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Fulvestrant DM0YZC6 Approved Fulvestrant decreases the secretion of Prolactin (PRL). [9]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol increases the secretion of Prolactin (PRL). [11]
Nicotine DMWX5CO Approved Nicotine increases the secretion of Prolactin (PRL). [12]
Clozapine DMFC71L Approved Clozapine increases the secretion of Prolactin (PRL). [13]
Propofol DMB4OLE Approved Propofol increases the secretion of Prolactin (PRL). [21]
Ranitidine DM0GUSX Approved Ranitidine increases the secretion of Prolactin (PRL). [36]
Cyproheptadine DM92AH3 Approved Cyproheptadine decreases the secretion of Prolactin (PRL). [44]
Chlorprothixene DMY0KGJ Approved Chlorprothixene increases the secretion of Prolactin (PRL). [54]
[3H]cAMP DMZRQU7 Investigative [3H]cAMP increases the secretion of Prolactin (PRL). [64]
Fluphenazine DMIT8LX Investigative Fluphenazine increases the secretion of Prolactin (PRL). [65]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)

References

1 Prolactin receptor antagonism reduces the clonogenic capacity of breast cancer cells and potentiates doxorubicin and paclitaxel cytotoxicity. Breast Cancer Res. 2008;10(4):R68. doi: 10.1186/bcr2129. Epub 2008 Aug 5.
2 Prolactinemia in adolescent males surviving malignancies in childhood: impaired dating activity. J Adolesc Health. 1993 Nov;14(7):543-7. doi: 10.1016/1054-139x(93)90138-f.
3 Novel estrogenic action of the pesticide residue beta-hexachlorocyclohexane in human breast cancer cells. Cancer Res. 1996 Dec 1;56(23):5403-9.
4 Multiple metals predict prolactin and thyrotropin (TSH) levels in men. Environ Res. 2009 Oct;109(7):869-73. doi: 10.1016/j.envres.2009.06.004.
5 Triclosan and bisphenol a affect decidualization of human endometrial stromal cells. Mol Cell Endocrinol. 2016 Feb 15;422:74-83. doi: 10.1016/j.mce.2015.11.017. Epub 2015 Nov 19.
6 The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
7 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
8 Progesterone-dependent release of transforming growth factor-beta1 from epithelial cells enhances the endometrial decidualization by turning on the Smad signalling in stromal cells. Mol Hum Reprod. 2005 Nov;11(11):801-8. doi: 10.1093/molehr/gah240. Epub 2006 Jan 10.
9 Differential effects of estrogen receptor antagonists on pituitary lactotroph proliferation and prolactin release. Mol Cell Endocrinol. 2005 Jul 15;239(1-2):27-36. doi: 10.1016/j.mce.2005.04.008.
10 Cyclic changes in the expression of p57(kip2) in human endometrium and its regulation by steroid hormones in endometrial stromal cells in vitro. Reprod Sci. 2012 Jan;19(1):92-101. doi: 10.1177/1933719111414209. Epub 2011 Nov 7.
11 Prolactin-secreting pituitary adenoma: occurrence following prenatal exposure to diethylstilbestrol. Cleve Clin Q. 1982 Winter;49(4):249-54. doi: 10.3949/ccjm.49.4.249.
12 Effects of intravenous cocaine and cigarette smoking on luteinizing hormone, testosterone, and prolactin in men. J Pharmacol Exp Ther. 2003 Oct;307(1):339-48. doi: 10.1124/jpet.103.052928. Epub 2003 Jul 31.
13 Risperidone-associated hyperprolactinemia. Endocr Pract. 2000 Nov-Dec;6(6):425-9. doi: 10.4158/EP.6.6.425.
14 Gene expression profile induced by BCNU in human glioma cell lines with differential MGMT expression. J Neurooncol. 2005 Jul;73(3):189-98.
15 Effects of cortisol and cocaine on plasma prolactin and growth hormone levels in cocaine-dependent volunteers. Addict Behav. 2005 May;30(4):859-64. doi: 10.1016/j.addbeh.2004.08.019.
16 Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
17 Elevated plasma prolactin in abstinent methamphetamine-dependent subjects. Am J Drug Alcohol Abuse. 2011 Jan;37(1):62-7. doi: 10.3109/00952990.2010.538945. Epub 2010 Dec 10.
18 The effects of olanzapine, risperidone, and haloperidol on plasma prolactin levels in patients with schizophrenia. Clin Ther. 2000 Sep;22(9):1085-96. doi: 10.1016/S0149-2918(00)80086-7.
19 Serum prolactin levels among outpatients with major depressive disorder during the acute phase of treatment with fluoxetine. J Clin Psychiatry. 2006 Jun;67(6):952-7. doi: 10.4088/jcp.v67n0612.
20 Dose-dependent separation of dopaminergic and adrenergic effects of epinine in healthy volunteers. Naunyn Schmiedebergs Arch Pharmacol. 1995 Oct;352(4):429-37. doi: 10.1007/BF00172781.
21 Propofol withdrawal seizures (or not). Seizure. 2008 Oct;17(7):665-7. doi: 10.1016/j.seizure.2008.03.004. Epub 2008 May 14.
22 Massive breast enlargement in a patient receiving D-penicillamine for systemic sclerosis. J Rheumatol. 1985 Oct;12(5):990-1.
23 Hyperprolactinaemia induced by proton pump inhibitor. J Pak Med Assoc. 2010 Aug;60(8):689-90.
24 Male sexual dysfunction during treatment with cimetidine. Br Med J. 1979 Mar 10;1(6164):659. doi: 10.1136/bmj.1.6164.659.
25 The effect of thioridazine on prolactinoma growth in a schizophrenic man: case report. Gen Hosp Psychiatry. 1985 Oct;7(4):364-6. doi: 10.1016/0163-8343(85)90053-2.
26 Neuroendocrine responsivity to clomipramine challenge test in neuroleptic naive psychotic patients before and after treatment with haloperidol. Eur Psychiatry. 1997;12(7):362-6. doi: 10.1016/s0924-9338(97)80006-5.
27 Cholinergic modulation of the cerebral metabolic response to citalopram in Alzheimer's disease. Brain. 2009 Feb;132(Pt 2):392-401. doi: 10.1093/brain/awn326. Epub 2009 Jan 19.
28 Clonidine-induced gynecomastia and hyperprolactinemia in a 6-year-old child. J Clin Psychiatry. 2005 Dec;66(12):1616-7. doi: 10.4088/jcp.v66n1219f.
29 Effects of terguride on anterior pituitary function in parkinsonian patients treated with L-dopa: a double-blind study versus placebo. Clin Neuropharmacol. 1996 Feb;19(1):72-80. doi: 10.1097/00002826-199619010-00006.
30 Hyperprolactinaemia during famotidine therapy. Lancet. 1993 Oct 2;342(8875):868. doi: 10.1016/0140-6736(93)92729-d.
31 Galactorrhoea may be associated with methadone use. BMJ. 2006 May 6;332(7549):1071. doi: 10.1136/bmj.332.7549.1071.
32 Long-term treatment of acromegaly with a long-acting analogue of somatostatin, octreotide. Q J Med. 1990 Feb;74(274):189-201.
33 Long-term follow-up of prolactinomas: normoprolactinemia after bromocriptine withdrawal. J Clin Endocrinol Metab. 2002 Aug;87(8):3578-82. doi: 10.1210/jcem.87.8.8722.
34 The efficacy, safety, and tolerability of aripiprazole for the treatment of schizoaffective disorder: results from a pooled analysis of a sub-population of subjects from two randomized, double-blind, placebo-controlled, pivotal trials. J Affect Disord. 2009 May;115(1-2):18-26. doi: 10.1016/j.jad.2008.12.017. Epub 2009 Feb 23.
35 Association of high prolactin levels and neuroleptics immediately postpartum. J Neuropsychiatry Clin Neurosci. 1990 Winter;2(1):115. doi: 10.1176/jnp.2.1.115b.
36 [Impotence and gynecomastia secondary to hyperprolactinemia induced by ranitidine]. Therapie. 1994 Jul-Aug;49(4):361-2.
37 Influence of naloxone on muscle sympathetic nerve activity, systemic and calf haemodynamics and ambulatory blood pressure after exercise in mild essential hypertension. J Hypertens. 1995 Apr;13(4):447-61.
38 [Importance of prolactin level indication in detection of Sheehan syndrome]. Ginekol Pol. 1992 May;63(5):232-5.
39 Growth hormone and prolactin secretion after metoclopramide administration (DA2 receptor blockade) in fertile women. Horm Metab Res. 2001 Sep;33(9):536-9. doi: 10.1055/s-2001-17214.
40 Extended-release paliperidone: efficacy, safety and tolerability profile of a new atypical antipsychotic. Drugs Today (Barc). 2007 Apr;43(4):249-58. doi: 10.1358/dot.2007.43.4.1067342.
41 Prolactin stimulation by intravenous labetalol is mediated inside the central nervous system. Clin Endocrinol (Oxf). 1982 Jun;16(6):615-9. doi: 10.1111/j.1365-2265.1982.tb03178.x.
42 Hyperprolactinemia and galactorrhea induced by serotonin and norepinephrine reuptake inhibiting antidepressants. Am J Psychiatry. 2007 Jul;164(7):1121-2. doi: 10.1176/ajp.2007.164.7.1121a.
43 Tryptophan and kynurenine stimulate human decidualization via activating Aryl hydrocarbon receptor: Short title: Kynurenine action on human decidualization. Reprod Toxicol. 2020 Sep;96:282-292. doi: 10.1016/j.reprotox.2020.07.011. Epub 2020 Aug 8.
44 [Toxicity of cyproheptadine. Side effects and accidental overdosage (author's transl)]. Monatsschr Kinderheilkd (1902). 1978 Mar;126(3):123-6.
45 D-Trp6-luteinizing hormone-releasing hormone inhibits sulpiride-induced hyperprolactinemia in normal men. J Clin Endocrinol Metab. 1987 Aug;65(2):368-9. doi: 10.1210/jcem-65-2-368.
46 Neonatal effects of methyldopa therapy in pregnancy hypertension. Acta Paediatr Hung. 1991;31(1):53-65.
47 Hormonal responses to the 5-HT1A agonist buspirone in remitted endogenous depressive patients after long-term imipramine treatment. Psychoneuroendocrinology. 2010 May;35(4):481-9. doi: 10.1016/j.psyneuen.2009.08.012. Epub 2009 Sep 16.
48 [Gynecomastia-galactorrhea during treatment with mirtazapine]. Presse Med. 2004 Apr 10;33(7):458. doi: 10.1016/s0755-4982(04)98631-9.
49 Prolactin monitoring of haloperidol and pimozide treatment in children with Tourette's syndrome. Biol Psychiatry. 1996 Nov 15;40(10):1044-50. doi: 10.1016/0006-3223(95)00596-X.
50 Aripiprazole for treatment-resistant schizophrenia: results of a multicenter, randomized, double-blind, comparison study versus perphenazine. J Clin Psychiatry. 2007 Feb;68(2):213-23.
51 Anxiogenic effect of yohimbine in healthy subjects: comparison with caffeine and antagonism by clonidine and diazepam. Int Clin Psychopharmacol. 1988 Jul;3(3):215-29. doi: 10.1097/00004850-198807000-00003.
52 Massive reduction of tumour load and normalisation of hyperprolactinaemia after high dose cabergoline in metastasised prolactinoma causing thoracic syringomyelia. J Neurol Neurosurg Psychiatry. 2004 Oct;75(10):1489-91. doi: 10.1136/jnnp.2003.028118.
53 Double-blind comparison of amoxapine and imipramine in the treatment of depressed patients. J Clin Psychiatry. 1984 Feb;45(2):54-56, 57-9.
54 Pharmacokinetic-pharmacodynamic modeling of tolerance to the prolactin-secreting effect of chlorprothixene after different modes of drug administration. J Pharmacol Exp Ther. 1999 Nov;291(2):547-54.
55 Doxapram-induced panic attacks and cortisol elevation. Psychiatry Res. 2005 Feb 28;133(2-3):253-61. doi: 10.1016/j.psychres.2004.10.010.
56 Differences in the effect of second-generation antipsychotics on prolactinaemia: six weeks open-label trial in female in-patients. Neuro Endocrinol Lett. 2007 Dec;28(6):881-8.
57 Effects of nalbuphine on anterior pituitary and adrenal hormones and subjective responses in male cocaine abusers. Pharmacol Biochem Behav. 2007 Apr;86(4):667-77. doi: 10.1016/j.pbb.2007.02.012. Epub 2007 Feb 20.
58 Pituitary apoplexy following chlorpromazine stimulation. Arch Intern Med. 1978 Nov;138(11):1738-9.
59 Serotonergic function in cocaine addicts: prolactin responses to sequential D,L-fenfluramine challenges. Biol Psychiatry. 1999 May 15;45(10):1300-6. doi: 10.1016/s0006-3223(98)00268-6.
60 Verapamil-induced hyperprolactinemia complicated by a pituitary incidentaloma. Ann Pharmacother. 1995 Oct;29(10):999-1001. doi: 10.1177/106002809502901009.
61 An open-label tolerability study of BL-1020 antipsychotic: a novel gamma aminobutyric acid ester of perphenazine. Clin Neuropharmacol. 2010 Nov-Dec;33(6):297-302. doi: 10.1097/WNF.0b013e3181f8d501.
62 Transdihydrolisuride in parkinsonism. Clin Neuropharmacol. 1987;10(1):57-64. doi: 10.1097/00002826-198702000-00005.
63 Bisphenol A modulates receptivity and secretory function of human decidual cells: an in vitro study. Reproduction. 2015 Aug;150(2):115-25. doi: 10.1530/REP-14-0601. Epub 2015 May 28.
64 Interleukin 11 and activin A synergise to regulate progesterone-induced but not cAMP-induced decidualization. J Reprod Immunol. 2010 Mar;84(2):124-32. doi: 10.1016/j.jri.2009.12.001. Epub 2010 Jan 13.
65 Clozapine and risperidone in chronic schizophrenia: effects on symptoms, parkinsonian side effects, and neuroendocrine response. Am J Psychiatry. 1999 Feb;156(2):294-8. doi: 10.1176/ajp.156.2.294.
66 A study of dopaminergic sensitivity in Parkinson's disease: comparison in "de novo" and levodopa-treated patients. Clin Neuropharmacol. 1996 Oct;19(5):420-7. doi: 10.1097/00002826-199619050-00005.
67 Relationship of disinhibition and aggression to blunted prolactin response to meta-chlorophenylpiperazine in cocaine-dependent patients. Psychopharmacology (Berl). 2006 Mar;185(1):123-32. doi: 10.1007/s00213-005-0261-7. Epub 2006 Jan 17.
68 Changes in nalorphine-induced hyperprolactinaemia after bromocriptine or sulpiride administration. Eur J Clin Pharmacol. 1982;22(4):375-6. doi: 10.1007/BF00548408.
69 Dynorphin A1-13 causes elevation of serum levels of prolactin through an opioid receptor mechanism in humans: gender differences and implications for modulation of dopaminergic tone in the treatment of addictions. J Pharmacol Exp Ther. 1999 Jan;288(1):260-9.
70 Prevalence of hyperprolactinemia in schizophrenic patients treated with conventional antipsychotic medications or risperidone. Psychoneuroendocrinology. 2003 Apr;28 Suppl 2:55-68. doi: 10.1016/s0306-4530(02)00127-0.
71 Effect of chronic hyperprolactinemia induced by sulpiride on plasma dehydroepiandrosterone (DHA) in normal men. Andrologia. 1986 Sep-Oct;18(5):523-8. doi: 10.1111/j.1439-0272.1986.tb01820.x.
72 Hyperprolactinemia and 5-alpha-reductase activity. Acta Eur Fertil. 1986 Mar-Apr;17(2):129-31.