Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWQN50N)

DOT Name Growth/differentiation factor 15 (GDF15)
Synonyms
GDF-15; Macrophage inhibitory cytokine 1; MIC-1; NSAID-activated gene 1 protein; NAG-1; NSAID-regulated gene 1 protein; NRG-1; Placental TGF-beta; Placental bone morphogenetic protein; Prostate differentiation factor
Gene Name GDF15
UniProt ID
GDF15_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
5VT2; 5VZ3; 5VZ4; 6Q2J
Pfam ID
PF00019
Sequence
MPGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGPSELHSEDSRFRELRKRY
EDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRL
HRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQL
ELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMC
IGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDL
LAKDCHCI
Function
Regulates food intake, energy expenditure and body weight in response to metabolic and toxin-induced stresses. Binds to its receptor, GFRAL, and activates GFRAL-expressing neurons localized in the area postrema and nucleus tractus solitarius of the brainstem. It then triggers the activation of neurons localized within the parabrachial nucleus and central amygdala, which constitutes part of the 'emergency circuit' that shapes feeding responses to stressful conditions. On hepatocytes, inhibits growth hormone signaling.
Tissue Specificity Highly expressed in placenta, with lower levels in prostate and colon and some expression in kidney . Detected in plasma (at protein level) .
KEGG Pathway
Cytokine-cytokine receptor interaction (hsa04060 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
100 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Growth/differentiation factor 15 (GDF15). [1]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Growth/differentiation factor 15 (GDF15). [2]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Growth/differentiation factor 15 (GDF15). [3]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Growth/differentiation factor 15 (GDF15). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Growth/differentiation factor 15 (GDF15). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Growth/differentiation factor 15 (GDF15). [6]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Growth/differentiation factor 15 (GDF15). [7]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Growth/differentiation factor 15 (GDF15). [8]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Growth/differentiation factor 15 (GDF15). [9]
Arsenic DMTL2Y1 Approved Arsenic decreases the expression of Growth/differentiation factor 15 (GDF15). [10]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Growth/differentiation factor 15 (GDF15). [11]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Growth/differentiation factor 15 (GDF15). [12]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Growth/differentiation factor 15 (GDF15). [13]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide increases the expression of Growth/differentiation factor 15 (GDF15). [14]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Growth/differentiation factor 15 (GDF15). [15]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Growth/differentiation factor 15 (GDF15). [16]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Growth/differentiation factor 15 (GDF15). [17]
Marinol DM70IK5 Approved Marinol decreases the expression of Growth/differentiation factor 15 (GDF15). [18]
Zoledronate DMIXC7G Approved Zoledronate decreases the expression of Growth/differentiation factor 15 (GDF15). [19]
Progesterone DMUY35B Approved Progesterone increases the expression of Growth/differentiation factor 15 (GDF15). [20]
Menadione DMSJDTY Approved Menadione increases the expression of Growth/differentiation factor 15 (GDF15). [14]
Fluorouracil DMUM7HZ Approved Fluorouracil increases the expression of Growth/differentiation factor 15 (GDF15). [21]
Dexamethasone DMMWZET Approved Dexamethasone decreases the expression of Growth/differentiation factor 15 (GDF15). [22]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of Growth/differentiation factor 15 (GDF15). [23]
Niclosamide DMJAGXQ Approved Niclosamide increases the expression of Growth/differentiation factor 15 (GDF15). [24]
Cannabidiol DM0659E Approved Cannabidiol increases the expression of Growth/differentiation factor 15 (GDF15). [25]
Isotretinoin DM4QTBN Approved Isotretinoin increases the expression of Growth/differentiation factor 15 (GDF15). [3]
Troglitazone DM3VFPD Approved Troglitazone increases the expression of Growth/differentiation factor 15 (GDF15). [26]
Hydroquinone DM6AVR4 Approved Hydroquinone increases the expression of Growth/differentiation factor 15 (GDF15). [27]
Rosiglitazone DMILWZR Approved Rosiglitazone increases the expression of Growth/differentiation factor 15 (GDF15). [28]
Azathioprine DMMZSXQ Approved Azathioprine increases the expression of Growth/differentiation factor 15 (GDF15). [29]
Ethanol DMDRQZU Approved Ethanol increases the expression of Growth/differentiation factor 15 (GDF15). [30]
Aspirin DM672AH Approved Aspirin increases the expression of Growth/differentiation factor 15 (GDF15). [31]
Etoposide DMNH3PG Approved Etoposide increases the expression of Growth/differentiation factor 15 (GDF15). [32]
Irinotecan DMP6SC2 Approved Irinotecan increases the expression of Growth/differentiation factor 15 (GDF15). [33]
Diclofenac DMPIHLS Approved Diclofenac increases the expression of Growth/differentiation factor 15 (GDF15). [34]
Piroxicam DMTK234 Approved Piroxicam decreases the expression of Growth/differentiation factor 15 (GDF15). [35]
Clozapine DMFC71L Approved Clozapine increases the expression of Growth/differentiation factor 15 (GDF15). [36]
Indomethacin DMSC4A7 Approved Indomethacin increases the expression of Growth/differentiation factor 15 (GDF15). [37]
Amphotericin B DMTAJQE Approved Amphotericin B increases the expression of Growth/differentiation factor 15 (GDF15). [38]
Mitomycin DMH0ZJE Approved Mitomycin increases the expression of Growth/differentiation factor 15 (GDF15). [39]
Cidofovir DMA13GD Approved Cidofovir increases the expression of Growth/differentiation factor 15 (GDF15). [40]
Fenofibrate DMFKXDY Approved Fenofibrate increases the expression of Growth/differentiation factor 15 (GDF15). [40]
Mitoxantrone DMM39BF Approved Mitoxantrone increases the expression of Growth/differentiation factor 15 (GDF15). [41]
Ifosfamide DMCT3I8 Approved Ifosfamide increases the expression of Growth/differentiation factor 15 (GDF15). [40]
Clodronate DM9Y6X7 Approved Clodronate decreases the expression of Growth/differentiation factor 15 (GDF15). [40]
Sulindac DM2QHZU Approved Sulindac increases the expression of Growth/differentiation factor 15 (GDF15). [42]
Capsaicin DMGMF6V Approved Capsaicin increases the expression of Growth/differentiation factor 15 (GDF15). [43]
Alitretinoin DMME8LH Approved Alitretinoin increases the expression of Growth/differentiation factor 15 (GDF15). [3]
Ibuprofen DM8VCBE Approved Ibuprofen increases the expression of Growth/differentiation factor 15 (GDF15). [40]
Lucanthone DMZLBUO Approved Lucanthone increases the expression of Growth/differentiation factor 15 (GDF15). [44]
Methamphetamine DMPM4SK Approved Methamphetamine increases the expression of Growth/differentiation factor 15 (GDF15). [45]
Daunorubicin DMQUSBT Approved Daunorubicin increases the expression of Growth/differentiation factor 15 (GDF15). [41]
Colchicine DM2POTE Approved Colchicine decreases the expression of Growth/differentiation factor 15 (GDF15). [39]
Hydroxyurea DMOQVU9 Approved Hydroxyurea increases the expression of Growth/differentiation factor 15 (GDF15). [39]
Adefovir dipivoxil DMMAWY1 Approved Adefovir dipivoxil increases the expression of Growth/differentiation factor 15 (GDF15). [40]
Adenine DMZLHKJ Approved Adenine decreases the expression of Growth/differentiation factor 15 (GDF15). [39]
Dihydroxyacetone DMM1LG2 Approved Dihydroxyacetone decreases the expression of Growth/differentiation factor 15 (GDF15). [46]
Mitotane DMU1GX0 Approved Mitotane increases the expression of Growth/differentiation factor 15 (GDF15). [47]
Phenylephrine DMZHUO5 Approved Phenylephrine affects the expression of Growth/differentiation factor 15 (GDF15). [48]
Flurbiprofen DMGN4BY Approved Flurbiprofen increases the expression of Growth/differentiation factor 15 (GDF15). [49]
Fludarabine DMVRLT7 Approved Fludarabine increases the expression of Growth/differentiation factor 15 (GDF15). [50]
Phloroglucinol DMUKMC8 Approved Phloroglucinol increases the expression of Growth/differentiation factor 15 (GDF15). [51]
Aceclofenac DMZDF0B Approved Aceclofenac increases the expression of Growth/differentiation factor 15 (GDF15). [34]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Growth/differentiation factor 15 (GDF15). [52]
Dihydrotestosterone DM3S8XC Phase 4 Dihydrotestosterone increases the expression of Growth/differentiation factor 15 (GDF15). [53]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Growth/differentiation factor 15 (GDF15). [54]
Resveratrol DM3RWXL Phase 3 Resveratrol increases the expression of Growth/differentiation factor 15 (GDF15). [55]
Fenretinide DMRD5SP Phase 3 Fenretinide increases the expression of Growth/differentiation factor 15 (GDF15). [56]
I3C DMIGFOR Phase 3 I3C increases the expression of Growth/differentiation factor 15 (GDF15). [57]
Genistein DM0JETC Phase 2/3 Genistein decreases the expression of Growth/differentiation factor 15 (GDF15). [58]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone increases the expression of Growth/differentiation factor 15 (GDF15). [59]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate increases the expression of Growth/differentiation factor 15 (GDF15). [60]
Netoglitazone DM8H7OA Phase 2 Netoglitazone increases the expression of Growth/differentiation factor 15 (GDF15). [61]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Growth/differentiation factor 15 (GDF15). [62]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Growth/differentiation factor 15 (GDF15). [63]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of Growth/differentiation factor 15 (GDF15). [64]
Arecoline DMFJZK3 Phase 1 Arecoline increases the expression of Growth/differentiation factor 15 (GDF15). [65]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Growth/differentiation factor 15 (GDF15). [66]
PMID27336223-Compound-5 DM6E50A Patented PMID27336223-Compound-5 increases the expression of Growth/differentiation factor 15 (GDF15). [28]
PMID26394986-Compound-22 DM43Z1G Patented PMID26394986-Compound-22 increases the expression of Growth/differentiation factor 15 (GDF15). [67]
PMID26560530-Compound-35 DMO36RL Patented PMID26560530-Compound-35 increases the expression of Growth/differentiation factor 15 (GDF15). [68]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN increases the expression of Growth/differentiation factor 15 (GDF15). [69]
Celastrol DMWQIJX Preclinical Celastrol increases the expression of Growth/differentiation factor 15 (GDF15). [70]
UNC0379 DMD1E4J Preclinical UNC0379 increases the expression of Growth/differentiation factor 15 (GDF15). [71]
Taxifolin DMQJSF9 Preclinical Taxifolin increases the expression of Growth/differentiation factor 15 (GDF15). [72]
NS398 DMINUWH Terminated NS398 increases the expression of Growth/differentiation factor 15 (GDF15). [73]
Wortmannin DM8EVK5 Terminated Wortmannin increases the expression of Growth/differentiation factor 15 (GDF15). [51]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Growth/differentiation factor 15 (GDF15). [22]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Growth/differentiation factor 15 (GDF15). [74]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Growth/differentiation factor 15 (GDF15). [75]
Coumestrol DM40TBU Investigative Coumestrol decreases the expression of Growth/differentiation factor 15 (GDF15). [8]
chloropicrin DMSGBQA Investigative chloropicrin increases the expression of Growth/differentiation factor 15 (GDF15). [76]
Acetaldehyde DMJFKG4 Investigative Acetaldehyde increases the expression of Growth/differentiation factor 15 (GDF15). [77]
Deguelin DMXT7WG Investigative Deguelin increases the expression of Growth/differentiation factor 15 (GDF15). [78]
methyl p-hydroxybenzoate DMO58UW Investigative methyl p-hydroxybenzoate increases the expression of Growth/differentiation factor 15 (GDF15). [79]
Paraquat DMR8O3X Investigative Paraquat increases the expression of Growth/differentiation factor 15 (GDF15). [80]
Nickel chloride DMI12Y8 Investigative Nickel chloride increases the expression of Growth/differentiation factor 15 (GDF15). [81]
[3H]methyltrienolone DMTSGOW Investigative [3H]methyltrienolone increases the expression of Growth/differentiation factor 15 (GDF15). [82]
Manganese DMKT129 Investigative Manganese increases the expression of Growth/differentiation factor 15 (GDF15). [83]
------------------------------------------------------------------------------------
⏷ Show the Full List of 100 Drug(s)

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Inter-laboratory comparison of human renal proximal tubule (HK-2) transcriptome alterations due to Cyclosporine A exposure and medium exhaustion. Toxicol In Vitro. 2009 Apr;23(3):486-99.
3 Retinoic acid and its 4-oxo metabolites are functionally active in human skin cells in vitro. J Invest Dermatol. 2005 Jul;125(1):143-53.
4 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
5 Doxorubicin induces cell senescence preferentially over apoptosis in the FU-SY-1 synovial sarcoma cell line. J Orthop Res. 2006 Jun;24(6):1163-9. doi: 10.1002/jor.20169.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 p53 hypersensitivity is the predominant mechanism of the unique responsiveness of testicular germ cell tumor (TGCT) cells to cisplatin. PLoS One. 2011 Apr 21;6(4):e19198. doi: 10.1371/journal.pone.0019198.
8 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
9 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
10 Gene expression patterns as potential molecular biomarkers for malignant transformation in human keratinocytes treated with MNNG, arsenic, or a metal mixture. Toxicol Sci. 2003 Jul;74(1):32-42. doi: 10.1093/toxsci/kfg124. Epub 2003 May 28.
11 Integrated assessment by multiple gene expression analysis of quercetin bioactivity on anticancer-related mechanisms in colon cancer cells in vitro. Eur J Nutr. 2005 Mar;44(3):143-56. doi: 10.1007/s00394-004-0503-1. Epub 2004 Apr 30.
12 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
13 Growth differentiation factor 15 production is necessary for normal erythroid differentiation and is increased in refractory anaemia with ring-sideroblasts. Br J Haematol. 2009 Jan;144(2):251-62. doi: 10.1111/j.1365-2141.2008.07441.x. Epub 2008 Nov 19.
14 Gene expression after treatment with hydrogen peroxide, menadione, or t-butyl hydroperoxide in breast cancer cells. Cancer Res. 2002 Nov 1;62(21):6246-54.
15 Calcitriol-induced prostate-derived factor: autocrine control of prostate cancer cell growth. Int J Cancer. 2004 Dec 20;112(6):951-8. doi: 10.1002/ijc.20510.
16 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
17 Epigenetic silencing of novel tumor suppressors in malignant melanoma. Cancer Res. 2006 Dec 1;66(23):11187-93. doi: 10.1158/0008-5472.CAN-06-1274.
18 Gene expression changes in human small airway epithelial cells exposed to Delta9-tetrahydrocannabinol. Toxicol Lett. 2005 Aug 14;158(2):95-107.
19 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
20 Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
21 Cell-type-specific responses to chemotherapeutics in breast cancer. Cancer Res. 2004 Jun 15;64(12):4218-26.
22 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
23 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
24 Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
25 Inhibiting Heat Shock Proteins Can Potentiate the Cytotoxic Effect of Cannabidiol in Human Glioma Cells. Anticancer Res. 2015 Nov;35(11):5827-37.
26 Expression of NAG-1, a transforming growth factor-beta superfamily member, by troglitazone requires the early growth response gene EGR-1. J Biol Chem. 2004 Feb 20;279(8):6883-92. doi: 10.1074/jbc.M305295200. Epub 2003 Dec 8.
27 In vitro effects of aldehydes present in tobacco smoke on gene expression in human lung alveolar epithelial cells. Toxicol In Vitro. 2013 Apr;27(3):1072-81.
28 PPARgamma controls CD1d expression by turning on retinoic acid synthesis in developing human dendritic cells. J Exp Med. 2006 Oct 2;203(10):2351-62.
29 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
30 Gene expression signatures after ethanol exposure in differentiating embryoid bodies. Toxicol In Vitro. 2018 Feb;46:66-76.
31 DNA array analysis of the effects of aspirin on colon cancer cells: involvement of Rac1. Carcinogenesis. 2004 Jul;25(7):1293-8.
32 Responses of genes involved in cell cycle control to diverse DNA damaging chemicals in human lung adenocarcinoma A549 cells. Cancer Cell Int. 2005 Aug 24;5:28. doi: 10.1186/1475-2867-5-28.
33 In vitro and in vivo irinotecan-induced changes in expression profiles of cell cycle and apoptosis-associated genes in acute myeloid leukemia cells. Mol Cancer Ther. 2005 Jun;4(6):885-900.
34 Cyclooxygenase inhibitors induce apoptosis in oral cavity cancer cells by increased expression of nonsteroidal anti-inflammatory drug-activated gene. Biochem Biophys Res Commun. 2004 Dec 24;325(4):1298-303. doi: 10.1016/j.bbrc.2004.10.176.
35 Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
36 Toxicoproteomics reveals an effect of clozapine on autophagy in human liver spheroids. Toxicol Mech Methods. 2023 Jun;33(5):401-410. doi: 10.1080/15376516.2022.2156005. Epub 2022 Dec 19.
37 Cyclooxygenase inhibitors induce the expression of the tumor suppressor gene EGR-1, which results in the up-regulation of NAG-1, an antitumorigenic protein. Mol Pharmacol. 2005 Feb;67(2):356-64. doi: 10.1124/mol.104.005108. Epub 2004 Oct 27.
38 Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
39 Utilization of CDKN1A/p21 gene for class discrimination of DNA damage-induced clastogenicity. Toxicology. 2014 Jan 6;315:8-16. doi: 10.1016/j.tox.2013.10.009. Epub 2013 Nov 6.
40 Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
41 Identification of genomic biomarkers for anthracycline-induced cardiotoxicity in human iPSC-derived cardiomyocytes: an in vitro repeated exposure toxicity approach for safety assessment. Arch Toxicol. 2016 Nov;90(11):2763-2777.
42 Expression profile analysis of colon cancer cells in response to sulindac or aspirin. Biochem Biophys Res Commun. 2002 Mar 29;292(2):498-512.
43 NSAID-activated gene-1 as a molecular target for capsaicin-induced apoptosis through a novel molecular mechanism involving GSK3beta, C/EBPbeta and ATF3. Carcinogenesis. 2010 Apr;31(4):719-28. doi: 10.1093/carcin/bgq016. Epub 2010 Jan 28.
44 Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
45 Methamphetamine alters the normal progression by inducing cell cycle arrest in astrocytes. PLoS One. 2014 Oct 7;9(10):e109603.
46 The sunless tanning agent dihydroxyacetone induces stress response gene expression and signaling in cultured human keratinocytes and reconstructed epidermis. Redox Biol. 2020 Sep;36:101594. doi: 10.1016/j.redox.2020.101594. Epub 2020 May 29.
47 Effects of mitotane on gene expression in the adrenocortical cell line NCI-H295R: a microarray study. Pharmacogenomics. 2012 Sep;13(12):1351-61. doi: 10.2217/pgs.12.116.
48 The haplotype of the growth-differentiation factor 15 gene is associated with left ventricular hypertrophy in human essential hypertension. Clin Sci (Lond). 2009 Oct 19;118(2):137-45. doi: 10.1042/CS20080637.
49 NSAID inhibition of prostate cancer cell migration is mediated by Nag-1 Induction via the p38 MAPK-p75(NTR) pathway. Mol Cancer Res. 2010 Dec;8(12):1656-64. doi: 10.1158/1541-7786.MCR-10-0342. Epub 2010 Nov 19.
50 Functional integrity of the p53-mediated apoptotic pathway induced by the nongenotoxic agent nutlin-3 in B-cell chronic lymphocytic leukemia (B-CLL). Blood. 2006 May 15;107(10):4122-9. doi: 10.1182/blood-2005-11-4465. Epub 2006 Jan 26.
51 Aspidin PB, a phloroglucinol derivative, induces apoptosis in human hepatocarcinoma HepG2 cells by modulating PI3K/Akt/GSK3 pathway. Chem Biol Interact. 2013 Jan 25;201(1-3):1-8. doi: 10.1016/j.cbi.2012.11.005. Epub 2012 Nov 21.
52 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
53 [Transcriptional regulation of placental transforming growth factor-beta by calcitriol in prostate cancer cells is androgen-independent]. Mol Biol (Mosk). 2006 Jan-Feb;40(1):84-9.
54 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
55 Resveratrol enhances the expression of non-steroidal anti-inflammatory drug-activated gene (NAG-1) by increasing the expression of p53. Carcinogenesis. 2002 Mar;23(3):425-34. doi: 10.1093/carcin/23.3.425.
56 The transforming growth factor-beta family members bone morphogenetic protein-2 and macrophage inhibitory cytokine-1 as mediators of the antiangiogenic activity of N-(4-hydroxyphenyl)retinamide. Clin Cancer Res. 2005 Jun 15;11(12):4610-9.
57 Indole-3-carbinol and 3,3'-diindolylmethane induce expression of NAG-1 in a p53-independent manner. Biochem Biophys Res Commun. 2005 Mar 4;328(1):63-9. doi: 10.1016/j.bbrc.2004.12.138.
58 Quantitative proteomics and transcriptomics addressing the estrogen receptor subtype-mediated effects in T47D breast cancer cells exposed to the phytoestrogen genistein. Mol Cell Proteomics. 2011 Jan;10(1):M110.002170.
59 Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
60 Morphological effects on expression of growth differentiation factor 15 (GDF15), a marker of metastasis. J Cell Physiol. 2014 Mar;229(3):362-73. doi: 10.1002/jcp.24458.
61 A peroxisome proliferator-activated receptor ligand MCC-555 imparts anti-proliferative response in pancreatic cancer cells by PPARgamma-independent up-regulation of KLF4. Toxicol Appl Pharmacol. 2012 Sep 1;263(2):225-32. doi: 10.1016/j.taap.2012.06.014. Epub 2012 Jun 30.
62 Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
63 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
64 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
65 Characterization of arecoline-induced effects on cytotoxicity in normal human gingival fibroblasts by global gene expression profiling. Toxicol Sci. 2007 Nov;100(1):66-74.
66 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
67 Preoperative growth inhibition of human gastric adenocarcinoma treated with a combination of celecoxib and octreotide. Acta Pharmacol Sin. 2007 Nov;28(11):1842-50. doi: 10.1111/j.1745-7254.2007.00652.x.
68 Rottlerin induces apoptosis of HT29 colon carcinoma cells through NAG-1 upregulation via an ERK and p38 MAPK-dependent and PKC -independent mechanism. Chem Biol Interact. 2012 Apr 15;197(1):1-7. doi: 10.1016/j.cbi.2012.02.003. Epub 2012 Mar 5.
69 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
70 Gene expression signature-based chemical genomic prediction identifies a novel class of HSP90 pathway modulators. Cancer Cell. 2006 Oct;10(4):321-30.
71 Epigenetic siRNA and chemical screens identify SETD8 inhibition as a therapeutic strategy for p53 activation in high-risk neuroblastoma. Cancer Cell. 2017 Jan 9;31(1):50-63.
72 The chemopreventive effect of taxifolin is exerted through ARE-dependent gene regulation. Biol Pharm Bull. 2007 Jun;30(6):1074-9.
73 Non-steroidal anti-inflammatory drug activated gene (NAG-1) expression is closely related to death receptor-4 and -5 induction, which may explain sulindac sulfide induced gastric cancer cell apoptosis. Carcinogenesis. 2004 Oct;25(10):1853-8. doi: 10.1093/carcin/bgh199. Epub 2004 Jun 3.
74 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
75 Regulation of chromatin assembly and cell transformation by formaldehyde exposure in human cells. Environ Health Perspect. 2017 Sep 21;125(9):097019.
76 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
77 Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
78 Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
79 Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
80 Cytotoxicity and gene array analysis of alveolar epithelial A549 cells exposed to paraquat. Chem Biol Interact. 2010 Dec 5;188(3):427-36.
81 The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
82 Analysis of the prostate cancer cell line LNCaP transcriptome using a sequencing-by-synthesis approach. BMC Genomics. 2006 Sep 29;7:246. doi: 10.1186/1471-2164-7-246.
83 Gene expression profiling of human primary astrocytes exposed to manganese chloride indicates selective effects on several functions of the cells. Neurotoxicology. 2007 May;28(3):478-89.