Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTYXVQX2)

• DOT Name: Limbic system-associated membrane protein (LSAMP)
• Synonyms: LSAMP; IgLON family member 3
• Gene Name: LSAMP
• Related Disease:
  Lung adenocarcinoma
  Neoplasm
  Tuberculosis
  African trypanosomiasis
  Anxiety disorder
  Bone osteosarcoma
  Brucellosis
  Chromosomal disorder
  Clear cell renal carcinoma
  Colon cancer
  Colorectal adenocarcinoma
  Colorectal cancer
  Colorectal cancer, susceptibility to, 1
  Colorectal cancer, susceptibility to, 10
  Colorectal cancer, susceptibility to, 12
  Colorectal carcinoma
  Colorectal neoplasm
  Danon disease
  Dengue
  Endometrium neoplasm
  Fatty liver disease
  Hepatitis
  Hepatitis C virus infection
  Major depressive disorder
  Malaria
  Mental disorder
  Metastatic malignant neoplasm
  Osteosarcoma
  Parkinson disease
  Prostate cancer
  Pulmonary tuberculosis
  Rabies
  Renal cell carcinoma
  rubella
  Ulcerative colitis
  Influenza
  Small lymphocytic lymphoma
  Carcinoma
  Adenoma
  Arteriosclerosis
  Atherosclerosis
  Cardiomyopathy
  Chikungunya virus infection
  Coronary heart disease
  Ebola virus infection
  Melanoma
  Prostate carcinoma
  Schizophrenia
• UniProt ID: LSAMP_HUMAN
• Pfam ID: PF07679 ; PF13927
• Sequence:
  MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNS
  KVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPK
  TSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEE
  YLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCE
  ASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTN
  ASLVLFRPGSVRGINGSISLAVPLWLLAASLLCLLSKC
• Function: Mediates selective neuronal growth and axon targeting. Contributes to the guidance of developing axons and remodeling of mature circuits in the limbic system. Essential for normal growth of the hippocampal mossy fiber projection.
• Tissue Specificity: Expressed on limbic neurons and fiber tracts as well as in single layers of the superior colliculus, spinal cord and cerebellum.
• Reactome Pathway: Post-translational modification (R-HSA-163125)

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung adenocarcinoma	DISD51WR	Definitive	Posttranslational Modification	[1]
Neoplasm	DISZKGEW	Definitive	Biomarker	[2]
Tuberculosis	DIS2YIMD	Definitive	Biomarker	[3]
African trypanosomiasis	DISBIXK4	Strong	Biomarker	[4]
Anxiety disorder	DISBI2BT	Strong	Biomarker	[5]
Bone osteosarcoma	DIST1004	Strong	Altered Expression	[6]
Brucellosis	DISEAYGH	Strong	Biomarker	[7]
Chromosomal disorder	DISM5BB5	Strong	Biomarker	[8]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[9]
Colon cancer	DISVC52G	Strong	Genetic Variation	[10]
Colorectal adenocarcinoma	DISPQOUB	Strong	Genetic Variation	[10]
Colorectal cancer	DISNH7P9	Strong	Genetic Variation	[10]
Colorectal cancer, susceptibility to, 1	DISZ794C	Strong	Genetic Variation	[10]
Colorectal cancer, susceptibility to, 10	DISQXMYM	Strong	Genetic Variation	[10]
Colorectal cancer, susceptibility to, 12	DIS4FXJX	Strong	Genetic Variation	[10]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[10]
Colorectal neoplasm	DISR1UCN	Strong	Genetic Variation	[10]
Danon disease	DIS45YLU	Strong	Genetic Variation	[11]
Dengue	DISKH221	Strong	Biomarker	[12]
Endometrium neoplasm	DIS6OS2L	Strong	Genetic Variation	[10]
Fatty liver disease	DIS485QZ	Strong	Altered Expression	[13]
Hepatitis	DISXXX35	Strong	Biomarker	[14]
Hepatitis C virus infection	DISQ0M8R	Strong	Altered Expression	[15]
Major depressive disorder	DIS4CL3X	Strong	Biomarker	[5]
Malaria	DISQ9Y50	Strong	Biomarker	[16]
Mental disorder	DIS3J5R8	Strong	Biomarker	[17]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[18]
Osteosarcoma	DISLQ7E2	Strong	Altered Expression	[6]
Parkinson disease	DISQVHKL	Strong	Altered Expression	[19]
Prostate cancer	DISF190Y	Strong	Genetic Variation	[20]
Pulmonary tuberculosis	DIS6FLUM	Strong	Biomarker	[21]
Rabies	DISSC4V5	Strong	Biomarker	[22]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[9]
rubella	DISXUI9P	Strong	Biomarker	[23]
Ulcerative colitis	DIS8K27O	Strong	Biomarker	[24]
Influenza	DIS3PNU3	moderate	Biomarker	[25]
Small lymphocytic lymphoma	DIS30POX	moderate	Biomarker	[26]
Carcinoma	DISH9F1N	Disputed	Biomarker	[27]
Adenoma	DIS78ZEV	Limited	Altered Expression	[28]
Arteriosclerosis	DISK5QGC	Limited	Altered Expression	[29]
Atherosclerosis	DISMN9J3	Limited	Altered Expression	[29]
Cardiomyopathy	DISUPZRG	Limited	Biomarker	[11]
Chikungunya virus infection	DISDXEHY	Limited	Biomarker	[30]
Coronary heart disease	DIS5OIP1	Limited	Biomarker	[29]
Ebola virus infection	DISJAVM1	Limited	Biomarker	[31]
Melanoma	DIS1RRCY	Limited	Biomarker	[2]
Prostate carcinoma	DISMJPLE	Limited	Genetic Variation	[20]
Schizophrenia	DISSRV2N	Limited	Biomarker	[32]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Daunorubicin	DMQUSBT	Approved	Limbic system-associated membrane protein (LSAMP) affects the response to substance of Daunorubicin.	[46]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Limbic system-associated membrane protein (LSAMP).	[33]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Limbic system-associated membrane protein (LSAMP).	[34]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Limbic system-associated membrane protein (LSAMP).	[35]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Limbic system-associated membrane protein (LSAMP).	[37]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Limbic system-associated membrane protein (LSAMP).	[38]
Marinol	DM70IK5	Approved	Marinol increases the expression of Limbic system-associated membrane protein (LSAMP).	[39]
Dasatinib	DMJV2EK	Approved	Dasatinib increases the expression of Limbic system-associated membrane protein (LSAMP).	[40]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Limbic system-associated membrane protein (LSAMP).	[41]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Limbic system-associated membrane protein (LSAMP).	[43]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Limbic system-associated membrane protein (LSAMP).	[44]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Limbic system-associated membrane protein (LSAMP).	[45]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Limbic system-associated membrane protein (LSAMP).	[36]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Limbic system-associated membrane protein (LSAMP).	[42]

References

• [1] Methylation-specific loop-mediated isothermal amplification for detecting hypermethylated DNA in simplex and multiplex formats.Clin Chem. 2010 Aug;56(8):1287-96. doi: 10.1373/clinchem.2010.143545. Epub 2010 Jun 15.
• [2] Melanoma LAMP-2C Modulates Tumor Growth and Autophagy.Front Cell Dev Biol. 2018 Aug 29;6:101. doi: 10.3389/fcell.2018.00101. eCollection 2018.
• [3] The human lung mucosa drives differential Mycobacterium tuberculosis infection outcome in the alveolar epithelium.Mucosal Immunol. 2019 May;12(3):795-804. doi: 10.1038/s41385-019-0156-2. Epub 2019 Mar 7.
• [4] Illuminating the Prevalence of Trypanosoma brucei s.l. in Glossina Using LAMP as a Tool for Xenomonitoring.PLoS Negl Trop Dis. 2016 Feb 18;10(2):e0004441. doi: 10.1371/journal.pntd.0004441. eCollection 2016 Feb.
• [5] Associations between LSAMP gene polymorphisms and major depressive disorder and panic disorder.Transl Psychiatry. 2012 Aug 14;2(8):e152. doi: 10.1038/tp.2012.74.
• [6] Reexpression of LSAMP inhibits tumor growth in a preclinical osteosarcoma model.Mol Cancer. 2014 Apr 28;13:93. doi: 10.1186/1476-4598-13-93.
• [7] Lateral flow biosensor combined with loop-mediated isothermal amplification for simple, rapid, sensitive, and reliable detection of Brucella spp.Infect Drug Resist. 2019 Jul 30;12:2343-2353. doi: 10.2147/IDR.S211644. eCollection 2019.
• [8] Identification of chromosomal aberrations associated with disease progression and a novel 3q13.31 deletion involving LSAMP gene in osteosarcoma.Int J Oncol. 2009 Oct;35(4):775-88. doi: 10.3892/ijo_00000390.
• [9] The t(1;3) breakpoint-spanning genes LSAMP and NORE1 are involved in clear cell renal cell carcinomas.Cancer Cell. 2003 Nov;4(5):405-13. doi: 10.1016/s1535-6108(03)00269-1.
• [10] Meta-analysis of genome-wide association studies identifies common susceptibility polymorphisms for colorectal and endometrial cancer near SH2B3 and TSHZ1.Sci Rep. 2015 Dec 1;5:17369. doi: 10.1038/srep17369.
• [11] LAMP-2B regulates human cardiomyocyte function by mediating autophagosome-lysosome fusion.Proc Natl Acad Sci U S A. 2019 Jan 8;116(2):556-565. doi: 10.1073/pnas.1808618116. Epub 2018 Dec 24.
• [12] Development and validation of four one-step real-time RT-LAMP assays for specific detection of each dengue virus serotype.PLoS Negl Trop Dis. 2018 May 29;12(5):e0006381. doi: 10.1371/journal.pntd.0006381. eCollection 2018 May.
• [13] SNX10 mediates alcohol-induced liver injury and steatosis by regulating the activation of chaperone-mediated autophagy.J Hepatol. 2018 Jul;69(1):129-141. doi: 10.1016/j.jhep.2018.01.038. Epub 2018 Feb 13.
• [14] Detection of HCV genotypes 1b and 2a by a reverse transcription loop-mediated isothermal amplification assay.J Med Virol. 2017 Jun;89(6):1048-1054. doi: 10.1002/jmv.24747. Epub 2017 Mar 14.
• [15] Hepatitis C Virus NS5A Protein Promotes the Lysosomal Degradation of Hepatocyte Nuclear Factor 1 via Chaperone-Mediated Autophagy.J Virol. 2018 Jun 13;92(13):e00639-18. doi: 10.1128/JVI.00639-18. Print 2018 Jul 1.
• [16] Sample-to-answer palm-sized nucleic acid testing device towards low-cost malaria mass screening.Biosens Bioelectron. 2018 Sep 15;115:83-90. doi: 10.1016/j.bios.2018.05.019. Epub 2018 May 19.
• [17] Increased sensitivity to psychostimulants and GABAergic drugs in Lsamp-deficient mice.Pharmacol Biochem Behav. 2019 Aug;183:87-97. doi: 10.1016/j.pbb.2019.05.010. Epub 2019 Jun 1.
• [18] Rapid detection of metastasis of gastric cancer using reverse transcription loop-mediated isothermal amplification.Int J Cancer. 2007 Mar 1;120(5):1063-9. doi: 10.1002/ijc.22397.
• [19] Therapeutic potentials of plant iridoids in Alzheimer's and Parkinson's diseases: A review.Eur J Med Chem. 2019 May 1;169:185-199. doi: 10.1016/j.ejmech.2019.03.009. Epub 2019 Mar 8.
• [20] A novel genomic alteration of LSAMP associates with aggressive prostate cancer in African American men.EBioMedicine. 2015 Oct 31;2(12):1957-64. doi: 10.1016/j.ebiom.2015.10.028. eCollection 2015 Dec.
• [21] Diagnostic accuracy of TB-LAMP for pulmonary tuberculosis: a systematic review and meta-analysis.BMC Infect Dis. 2019 Mar 19;19(1):268. doi: 10.1186/s12879-019-3881-y.
• [22] Comparison of Reverse Transcription Loop-Mediated Isothermal Amplification Method with SYBR Green Real-Time RT-PCR and Direct Fluorescent Antibody Test for Diagnosis of Rabies.Jpn J Infect Dis. 2020 Jan 23;73(1):19-25. doi: 10.7883/yoken.JJID.2019.009. Epub 2019 Aug 30.
• [23] Development of an improved RT-LAMP assay for detection of currently circulating rubella viruses.J Virol Methods. 2014 Oct;207:73-7. doi: 10.1016/j.jviromet.2014.06.013. Epub 2014 Jun 24.
• [24] Genome-Wide Association Study Identifies African-Specific Susceptibility Loci in African Americans With Inflammatory Bowel Disease.Gastroenterology. 2017 Jan;152(1):206-217.e2. doi: 10.1053/j.gastro.2016.09.032. Epub 2016 Sep 28.
• [25] Evaluation of clinical applicability of reverse transcription-loop-mediated isothermal amplification assay for detection and subtyping of Influenza A viruses.J Virol Methods. 2018 Mar;253:18-25. doi: 10.1016/j.jviromet.2017.12.005. Epub 2017 Dec 15.
• [26] Customized oligonucleotide array-based comparative genomic hybridization as a clinical assay for genomic profiling of chronic lymphocytic leukemia.J Mol Diagn. 2009 Jan;11(1):25-34. doi: 10.2353/jmoldx.2009.080037. Epub 2008 Dec 12.
• [27] Expression of cellular adhesion molecule 'OPCML' is down-regulated in gliomas and other brain tumours.Neuropathol Appl Neurobiol. 2007 Feb;33(1):77-85. doi: 10.1111/j.1365-2990.2006.00786.x.
• [28] Expression of lysosome-associated membrane proteins in human colorectal neoplasms and inflammatory diseases.Am J Pathol. 2001 Aug;159(2):449-55. doi: 10.1016/S0002-9440(10)61716-6.
• [29] Polymorphisms of the tumor suppressor gene LSAMP are associated with left main coronary artery disease.Ann Hum Genet. 2008 Jul;72(Pt 4):443-53. doi: 10.1111/j.1469-1809.2008.00433.x. Epub 2008 Jul 3.
• [30] Development of a single-tube one-step RT-LAMP assay to detect the Chikungunya virus genome.PLoS Negl Trop Dis. 2018 May 29;12(5):e0006448. doi: 10.1371/journal.pntd.0006448. eCollection 2018 May.
• [31] Rapid detection of all known ebolavirus species by reverse transcription-loop-mediated isothermal amplification (RT-LAMP).J Virol Methods. 2017 Aug;246:8-14. doi: 10.1016/j.jviromet.2017.03.011. Epub 2017 Mar 27.
• [32] Altered Expression Profile of IgLON Family of Neural Cell Adhesion Molecules in the Dorsolateral Prefrontal Cortex of Schizophrenic Patients.Front Mol Neurosci. 2018 Jan 29;11:8. doi: 10.3389/fnmol.2018.00008. eCollection 2018.
• [33] Design principles of concentration-dependent transcriptome deviations in drug-exposed differentiating stem cells. Chem Res Toxicol. 2014 Mar 17;27(3):408-20.
• [34] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [35] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [36] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [37] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [38] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [39] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [40] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [41] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [42] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [43] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [44] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [45] Cellular reactions to long-term volatile organic compound (VOC) exposures. Sci Rep. 2016 Dec 1;6:37842. doi: 10.1038/srep37842.
• [46] Mapping genes that contribute to daunorubicin-induced cytotoxicity. Cancer Res. 2007 Jun 1;67(11):5425-33. doi: 10.1158/0008-5472.CAN-06-4431.