Details of the Drug

General Information of Drug (ID: DM6Q4B0)

Drug Name

Anistreplase

Indication

Disease Entry	ICD 11	Status	REF
Acute coronary syndrome	BA41	Approved	[1]
------------------------------------------------------------------------------------

Therapeutic Class

Thrombolytic Agents

Sequence

SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGG
TCQQALYFSDFVCQCPEGFAGKCCEIDTRATCYEDQGISYRGTWSTAESGAECTNWNSSA
LAQKPYSGRRPDAIRLGLGNHNYCRNPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDC
YFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAK
PWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRS
PGERFLCGGILISSCWILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVH
KEFDDDTYDNDIALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEAL
SPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGG
PLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP

Cross-matching ID

DrugBank ID: DB00029
TTD ID: D0K4DI

Molecular Interaction Atlas of This Drug

Drug Therapeutic Target (DTT)

DTT Name	DTT ID	UniProt ID	MOA	REF
Plasminogen (PLG)	TTP86E2	PLMN_HUMAN	Activator	[2]

------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

The Studied Disease

Acute coronary syndrome

ICD Disease Classification

BA41

Molecule Name	Molecule Type	Gene Name	p-value	Fold-Change	Z-score
Plasminogen (PLG)	DTT	PLG	8.61E-01	-0.01	-0.09

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Same Disease as Anistreplase

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Disease	REF
Prasugrel	DM7MT6E	Major	Increased risk of bleeding by the combination of Anistreplase and Prasugrel.	Myocardial infarction [BA41-BA43]	[3]
Vorapaxar	DMA16BR	Major	Increased risk of bleeding by the combination of Anistreplase and Vorapaxar.	Myocardial infarction [BA41-BA43]	[4]
-----------

Coadministration of a Drug Treating the Disease Different from Anistreplase (Comorbidity)

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Comorbidity	REF
Cilostazol	DMZMSCT	Moderate	Increased risk of bleeding by the combination of Anistreplase and Cilostazol.	Arterial occlusive disease [BD40]	[5]
Drotrecogin alfa	DM59JCN	Major	Increased risk of bleeding by the combination of Anistreplase and Drotrecogin alfa.	Cerebral ischaemia [8B1Z]	[6]
Pentosan polysulfate	DM2HRKE	Moderate	Increased risk of bleeding by the combination of Anistreplase and Pentosan polysulfate.	Chronic pain [MG30]	[7]
Ketoprofen	DMRKXPT	Moderate	Increased risk of bleeding by the combination of Anistreplase and Ketoprofen.	Chronic pain [MG30]	[8]
Levomilnacipran	DMV26S8	Moderate	Increased risk of bleeding by the combination of Anistreplase and Levomilnacipran.	Chronic pain [MG30]	[9]
Regorafenib	DMHSY1I	Major	Increased risk of bleeding by the combination of Anistreplase and Regorafenib.	Colorectal cancer [2B91]	[3]
Intedanib	DMSTA36	Moderate	Increased risk of bleeding by the combination of Anistreplase and Intedanib.	Colorectal cancer [2B91]	[10]
Ardeparin	DMYRX8B	Major	Increased risk of bleeding by the combination of Anistreplase and Ardeparin.	Coronary thrombosis [BA43]	[11]
Rivaroxaban	DMQMBZ1	Major	Increased risk of bleeding by the combination of Anistreplase and Rivaroxaban.	Deep vein thrombosis [BD71]	[12]
Sertraline	DM0FB1J	Moderate	Increased risk of bleeding by the combination of Anistreplase and Sertraline.	Depression [6A70-6A7Z]	[9]
Fluoxetine	DM3PD2C	Moderate	Increased risk of bleeding by the combination of Anistreplase and Fluoxetine.	Depression [6A70-6A7Z]	[9]
Vilazodone	DM4LECQ	Moderate	Increased risk of bleeding by the combination of Anistreplase and Vilazodone.	Depression [6A70-6A7Z]	[9]
Paroxetine	DM5PVQE	Moderate	Increased risk of bleeding by the combination of Anistreplase and Paroxetine.	Depression [6A70-6A7Z]	[9]
Vortioxetine	DM6F1PU	Moderate	Increased risk of bleeding by the combination of Anistreplase and Vortioxetine.	Depression [6A70-6A7Z]	[9]
Duloxetine	DM9BI7M	Moderate	Increased risk of bleeding by the combination of Anistreplase and Duloxetine.	Depression [6A70-6A7Z]	[9]
Milnacipran	DMBFE74	Moderate	Increased risk of bleeding by the combination of Anistreplase and Milnacipran.	Depression [6A70-6A7Z]	[9]
Escitalopram	DMFK9HG	Moderate	Increased risk of bleeding by the combination of Anistreplase and Escitalopram.	Depression [6A70-6A7Z]	[9]
Desvenlafaxine	DMHD4PE	Moderate	Increased risk of bleeding by the combination of Anistreplase and Desvenlafaxine.	Depression [6A70-6A7Z]	[9]
Clomipramine	DMINRKW	Moderate	Increased risk of bleeding by the combination of Anistreplase and Clomipramine.	Depression [6A70-6A7Z]	[9]
Fluvoxamine	DMQTJSX	Moderate	Increased risk of bleeding by the combination of Anistreplase and Fluvoxamine.	Depression [6A70-6A7Z]	[9]
Venlafaxine	DMR6QH0	Moderate	Increased risk of bleeding by the combination of Anistreplase and Venlafaxine.	Depression [6A70-6A7Z]	[9]
Apigenin	DMI3491	Minor	Increased risk of bleeding by the combination of Anistreplase and Apigenin.	Discovery agent [N.A.]	[13]
Citalopram derivative 1	DMITX1G	Moderate	Increased risk of bleeding by the combination of Anistreplase and Citalopram derivative 1.	Discovery agent [N.A.]	[9]
PMID28870136-Compound-49	DMTUC9E	Moderate	Increased risk of bleeding by the combination of Anistreplase and PMID28870136-Compound-49.	Discovery agent [N.A.]	[14]
Fenfluramine	DM0762O	Moderate	Increased risk of bleeding by the combination of Anistreplase and Fenfluramine.	Epilepsy/seizure [8A61-8A6Z]	[9]
Suprofen	DMKXJZ7	Moderate	Increased risk of bleeding by the combination of Anistreplase and Suprofen.	Eye anterior segment structural developmental anomaly [LA11]	[8]
Mefenamic acid	DMK7HFI	Moderate	Increased risk of bleeding by the combination of Anistreplase and Mefenamic acid.	Female pelvic pain [GA34]	[8]
Avapritinib	DMK2GZX	Major	Increased risk of bleeding by the combination of Anistreplase and Avapritinib.	Gastrointestinal stromal tumour [2B5B]	[3]
Ramipril	DM2R68E	Moderate	Increased risk of angioedema by the combination of Anistreplase and Ramipril.	Heart failure [BD10-BD1Z]	[15]
Tipranavir	DM8HJX6	Major	Increased risk of bleeding by the combination of Anistreplase and Tipranavir.	Human immunodeficiency virus disease [1C60-1C62]	[16]
Captopril	DM458UM	Moderate	Increased risk of angioedema by the combination of Anistreplase and Captopril.	Hypertension [BA00-BA04]	[15]
Trandolapril	DM4L6EU	Moderate	Increased risk of angioedema by the combination of Anistreplase and Trandolapril.	Hypertension [BA00-BA04]	[15]
Fosinopril	DM9NJ52	Moderate	Increased risk of angioedema by the combination of Anistreplase and Fosinopril.	Hypertension [BA00-BA04]	[15]
Enalapril	DMNFUZR	Moderate	Increased risk of angioedema by the combination of Anistreplase and Enalapril.	Hypertension [BA00-BA04]	[15]
Perindopril	DMOPZDT	Moderate	Increased risk of angioedema by the combination of Anistreplase and Perindopril.	Hypertension [BA00-BA04]	[15]
Quinapril	DMR8H31	Moderate	Increased risk of angioedema by the combination of Anistreplase and Quinapril.	Hypertension [BA00-BA04]	[15]
Lisinopril	DMUOK4C	Moderate	Increased risk of angioedema by the combination of Anistreplase and Lisinopril.	Hypertension [BA00-BA04]	[15]
Dipyridamole	DMXY30O	Moderate	Increased risk of bleeding by the combination of Anistreplase and Dipyridamole.	Hypertension [BA00-BA04]	[5]
Meclofenamic acid	DM05FXR	Moderate	Increased risk of bleeding by the combination of Anistreplase and Meclofenamic acid.	Inflammatory spondyloarthritis [FA92]	[8]
Ticlopidine	DMO946V	Moderate	Increased risk of bleeding by the combination of Anistreplase and Ticlopidine.	Ischaemic/haemorrhagic stroke [8B20]	[5]
Acalabrutinib	DM7GCVW	Major	Increased risk of bleeding by the combination of Anistreplase and Acalabrutinib.	Mature B-cell lymphoma [2A85]	[17]
Ibrutinib	DMHZCPO	Major	Increased risk of bleeding by the combination of Anistreplase and Ibrutinib.	Mature B-cell lymphoma [2A85]	[18]
Ponatinib	DMYGJQO	Major	Increased risk of bleeding by the combination of Anistreplase and Ponatinib.	Mature B-cell lymphoma [2A85]	[19]
Panobinostat	DM58WKG	Major	Increased risk of bleeding by the combination of Anistreplase and Panobinostat.	Multiple myeloma [2A83]	[15]
Dasatinib	DMJV2EK	Major	Increased risk of bleeding by the combination of Anistreplase and Dasatinib.	Myeloproliferative neoplasm [2A20]	[20]
Omacetaxine mepesuccinate	DMPU2WX	Major	Increased risk of bleeding by the combination of Anistreplase and Omacetaxine mepesuccinate.	Myeloproliferative neoplasm [2A20]	[7]
Sibutramine	DMFJTDI	Moderate	Increased risk of bleeding by the combination of Anistreplase and Sibutramine.	Obesity [5B80-5B81]	[21]
Diclofenac	DMPIHLS	Moderate	Increased risk of bleeding by the combination of Anistreplase and Diclofenac.	Osteoarthritis [FA00-FA05]	[8]
Nepafenac	DMYK490	Moderate	Increased risk of bleeding by the combination of Anistreplase and Nepafenac.	Osteoarthritis [FA00-FA05]	[8]
Naproxen	DMZ5RGV	Moderate	Increased risk of bleeding by the combination of Anistreplase and Naproxen.	Osteoarthritis [FA00-FA05]	[8]
MK-4827	DMLYGH4	Moderate	Increased risk of bleeding by the combination of Anistreplase and MK-4827.	Ovarian cancer [2C73]	[3]
Aspirin	DM672AH	Moderate	Increased risk of bleeding by the combination of Anistreplase and Aspirin.	Pain [MG30-MG3Z]	[5]
Etodolac	DM6WJO9	Moderate	Increased risk of bleeding by the combination of Anistreplase and Etodolac.	Pain [MG30-MG3Z]	[8]
Diflunisal	DM7EN8I	Moderate	Increased risk of bleeding by the combination of Anistreplase and Diflunisal.	Pain [MG30-MG3Z]	[5]
Ibuprofen	DM8VCBE	Moderate	Increased risk of bleeding by the combination of Anistreplase and Ibuprofen.	Pain [MG30-MG3Z]	[8]
Nabumetone	DMAT2XH	Moderate	Increased risk of bleeding by the combination of Anistreplase and Nabumetone.	Pain [MG30-MG3Z]	[8]
Piroxicam	DMTK234	Moderate	Increased risk of bleeding by the combination of Anistreplase and Piroxicam.	Pain [MG30-MG3Z]	[8]
Choline salicylate	DM8P137	Moderate	Increased risk of bleeding by the combination of Anistreplase and Choline salicylate.	Postoperative inflammation [1A00-CA43]	[5]
Ketorolac	DMI4EL5	Moderate	Increased risk of bleeding by the combination of Anistreplase and Ketorolac.	Postoperative inflammation [1A00-CA43]	[8]
Bromfenac	DMKB79O	Moderate	Increased risk of bleeding by the combination of Anistreplase and Bromfenac.	Postoperative inflammation [1A00-CA43]	[8]
Treprostinil	DMTIQF3	Moderate	Increased risk of bleeding by the combination of Anistreplase and Treprostinil.	Pulmonary hypertension [BB01]	[5]
Epoprostenol	DMUTYR2	Moderate	Increased risk of bleeding by the combination of Anistreplase and Epoprostenol.	Pulmonary hypertension [BB01]	[5]
Iloprost	DMVPZBE	Moderate	Increased risk of bleeding by the combination of Anistreplase and Iloprost.	Pulmonary hypertension [BB01]	[5]
Salsalate	DM13P4C	Moderate	Increased risk of bleeding by the combination of Anistreplase and Salsalate.	Rheumatoid arthritis [FA20]	[5]
Meloxicam	DM2AR7L	Moderate	Increased risk of bleeding by the combination of Anistreplase and Meloxicam.	Rheumatoid arthritis [FA20]	[8]
Sulindac	DM2QHZU	Moderate	Increased risk of bleeding by the combination of Anistreplase and Sulindac.	Rheumatoid arthritis [FA20]	[8]
Oxaprozin	DM9UB0P	Moderate	Increased risk of bleeding by the combination of Anistreplase and Oxaprozin.	Rheumatoid arthritis [FA20]	[8]
Flurbiprofen	DMGN4BY	Moderate	Increased risk of bleeding by the combination of Anistreplase and Flurbiprofen.	Rheumatoid arthritis [FA20]	[8]
Fenoprofen	DML5VQ0	Moderate	Increased risk of bleeding by the combination of Anistreplase and Fenoprofen.	Rheumatoid arthritis [FA20]	[8]
Indomethacin	DMSC4A7	Moderate	Increased risk of bleeding by the combination of Anistreplase and Indomethacin.	Rheumatoid arthritis [FA20]	[8]
Tolmetin	DMWUIJE	Moderate	Increased risk of bleeding by the combination of Anistreplase and Tolmetin.	Rheumatoid arthritis [FA20]	[8]
Curcumin	DMQPH29	Minor	Increased risk of bleeding by the combination of Anistreplase and Curcumin.	Solid tumour/cancer [2A00-2F9Z]	[22]
Warfarin	DMJYCVW	Major	Increased risk of bleeding by the combination of Anistreplase and Warfarin.	Supraventricular tachyarrhythmia [BC81]	[23]
Caplacizumab	DMPUKA7	Major	Increased risk of bleeding by the combination of Anistreplase and Caplacizumab.	Thrombocytopenia [3B64]	[15]
Apixaban	DM89JLN	Major	Increased risk of bleeding by the combination of Anistreplase and Apixaban.	Thrombosis [DB61-GB90]	[3]
Cangrelor	DM8JRH0	Major	Increased risk of bleeding by the combination of Anistreplase and Cangrelor.	Thrombosis [DB61-GB90]	[24]
Brilinta	DMBR01X	Moderate	Increased risk of bleeding by the combination of Anistreplase and Brilinta.	Thrombosis [DB61-GB90]	[3]
Argatroban	DMFI46A	Major	Increased risk of bleeding by the combination of Anistreplase and Argatroban.	Thrombosis [DB61-GB90]	[25]
Clopidogrel	DMOL54H	Moderate	Increased risk of bleeding by the combination of Anistreplase and Clopidogrel.	Thrombosis [DB61-GB90]	[5]
Cabozantinib	DMIYDT4	Major	Increased risk of bleeding by the combination of Anistreplase and Cabozantinib.	Thyroid cancer [2D10]	[26]
Betrixaban	DM2C4RF	Major	Increased risk of bleeding by the combination of Anistreplase and Betrixaban.	Venous thromboembolism [BD72]	[24]
-----------


⏷ Show the Full List of 81 DDI Information of This Drug

References

1	Acylated plasminogen-streptokinase activator complex: a new approach to thrombolytic therapy. Pharmacotherapy. 1990;10(2):115-26.
2	Evaluation of thrombolytic agents. Drugs. 1997;54 Suppl 3:11-6; discussion 16-7.
3	Cerner Multum, Inc. "UK Summary of Product Characteristics.".
4	Product Information. Zontivity (vorapaxar). Merck & Company Inc, Whitehouse Station, NJ.
5	Harder S, Klinkhardt U "Thrombolytics: drug interactions of clinical significance." Drug Saf 23 (2000): 391-9. [PMID: 11085346]
6	Product Information. Xigris (drotrecogin alfa). Lilly, Eli and Company, Indianapolis, IN.
7	Product Information. Brukinsa (zanubrutinib). BeiGene USA, Inc, San Mateo, CA.
8	Product Information. Acular (ketorolac). Allergan Inc, Irvine, CA.
9	Alderman CP, Moritz CK, Ben-Tovim DI "Abnormal platelet aggregation associated with fluoxetine therapy." Ann Pharmacother 26 (1992): 1517-9. [PMID: 1482806]
10	Product Information. Ofev (nintedanib). Boehringer Ingelheim, Ridgefield, CT.
11	Price AJ, Frcpath DO "Is there a clinical interaction between low molecular weight heparin and non-steroidal analgesics after total hip replacement?" Ann R Coll Surg Engl 77 (1995): 395. [PMID: 7486773]
12	Product Information. Xarelto (rivaroxaban). Bayer Inc, Toronto, IA.
13	Heck AM, DeWitt BA, Lukes AL "Potential interactions between alternative therapies and warfarin." Am J Health Syst Pharm 57 (2000): 1221-7 quiz 1228-30. [PMID: 10902065]
14	Canadian Pharmacists Association.
15	Cerner Multum, Inc. "Australian Product Information.".
16	Product Information. Aptivus (tipranavir). Boehringer-Ingelheim, Ridgefield, CT.
17	Product Information. Calquence (acalabrutinib). Astra-Zeneca Pharmaceuticals, Wilmington, DE.
18	Agencia Espaola de Medicamentos y Productos Sanitarios Healthcare "Centro de informacion online de medicamentos de la AEMPS - CIMA.".
19	Product Information. Iclusig (ponatinib). Ariad Pharmaceuticals Inc, Cambridge, MA.
20	Product Information. Sprycel (dasatinib). Bristol-Myers Squibb, Princeton, NJ.
21	Bannister SJ, Houser VP, Hulse JD, Kisicki JC, Rasmussen JG "Evaluation of the potential for interactions of paroxetine with diazepam, cimetidine, warfarin, and digoxin." Acta Psychiatr Scand Suppl 350 (1989): 102-6. [PMID: 2530759]
22	Abebe W "Herbal medication: potential for adverse interactions with analgesic drugs." J Clin Pharm Ther 27 (2002): 391-401. [PMID: 12472978]
23	Arora RR, Magun AM, Grossman M, Katz J "Cholesterol embolization syndrome after intravenous tissue plasminogen activator for acute myocardial infarction." Am Heart J 126 (1993): 225-8. [PMID: 8322670]
24	Bodiford AB, Kessler FO, Fermo JD, Ragucci KR "Elevated international normalized ratio with the consumption of grapefruit and use of warfarin." SAGE Open Med Case Rep 0 (2013): 1-3. [PMID: 27489634]
25	Product Information. Acova (argatroban) SmithKline Beecham, Philadelphia, PA.
26	Product Information. Cometriq (cabozantinib). Exelixis Inc, S San Francisco, CA.